[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56844.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bwzA.bssp"
#ERROR : Can't open dsspfile "3ejxD.bssp"
#ERROR : Can't open dsspfile "3ejxB.bssp"
#ERROR : Can't open dsspfile "3ejxA.bssp"
#ERROR : Can't open dsspfile "3ednA.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "2azpA.bssp"
#ERROR : Can't open dsspfile "2edmA.bssp"

## Summary of PDB Search
:276
    1e-69  49%  1bwzA  [d.21.1 - d.21.1] PROTEIN (DIAMINOPIMELATE EPIMERASE)
    1e-66  36%  3ejxD  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    9e-52  37%  3ejxB  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    7e-51  37%  3ejxA  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    1e-50  15%  3ednA  [x.x.x] PHENAZINE BIOSYNTHESIS PROTEIN, PHZF FAMILY
    3e-24   9%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    4e-24  15%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    5e-18  18%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    5e-18  18%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    5e-17   7%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    7e-15   9%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    3e-09  13%  2azpA  [x.x.x] HYPOTHETICAL PROTEIN PA1268
    2e-04  15%  2edmA  [x.x.x] 22KDA STRUCTURAL PROTEIN VP22
:276

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
1bwzA           --MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
3ejxD           --LHFVKYHGLGNDFILVDNRSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGV-NGTDYAMRIFNSDGS
3ejxB           -VLHFVKYHGLGNDFLVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGV-NGTDYAMRIFNSDGS
3ejxA           -VLHFVKYHGLGNDFILVDNRDSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVNGT-DYAMRIFNSDGS
3ednA           FHYDAFTNKPNGNPAGIVLDADG----LTEEEQRIAEK---VGFNETSFVLSSE----VADIRRYFTPG-
2c4mC           ------KTRAIPYDMPITGYGTHNV-GTLRLWKAEPWEEFDYDAFNAQRFTDAIIERERVSDICRVLYPN
1e4oA           ----QVGIGGKV---TKDGRWEPEF-----TITGQAWDLPVVGYRNGVAQPLRLWQATPFDLTKFNDDFL
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
2c4mA           --FDDMKTRAIPYDMPITGYGTHNVG-TLRLWKAEPWEEFDYDAFNAQRFTDAIIERERVCRVLYPNDTT
2c4mB           ---------AIPYDMPITGYGTHNVG-TLRLWKAEPWEEFDYDAFNAQRFTDAIIERERVCRVLYPNDTT
2azpA           -RIRIIDSHTGGEPTRLVIGGFPDLGQGDMAERRRLLGERHDAWRAACILCAPVDPEACAGVIFFNNS-G
2edmA           ----------------------------------------------------------NMTLKILNNTG-


                         .         .         *         .         .         .         .:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
1bwzA           EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIRVNMGEPIWEPAKIPFTANKFEKN
3ejxD           EPEMCGNGVRCFARFIAELENQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSGNKGE
3ejxB           EPEMCGNGVRCFARFAELENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSGNKGE
3ejxA           EPEMCGNGVRCFARFIAELENQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKLSGNKGE
3ednA           YEDLCGHGTVGTIYALRERGLEEKASLTIETKAGILPIQIGVNENFIKRQTAPQFKDFAGSKEELAHSIG
2c4mC           DTTYEGKKLRVRQQYFFTSA-SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMRLLMDEHDM
1e4oA           RAEQQGINAEKLTKVLYPNDNHTADILRRHHLAGRKLHELADYEVIQLNDTHPTIAIPELLRVLIDEHQM
1ahpA           -------------------------ILRRHHLAGRELHELADYEVIQLNDTHPTIAIPELLRVIDEHQMS
2ecpA           -------------------------ILRRHHLAGRELHELADYEVIQLNDTHPTIAIPELLRVIDEHQMS
2c4mA           YEGKKLRVRQQYFFTSA----SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMR----LLMD
2c4mB           Y---EGKKLRVRQQYFFTSA-SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMRLLMDEHDM
2azpA           YLGMCGHGTIGLVASLAHLGRIGPGVHRIETPVGEVEATLHEDGSVSVRNVPAYRYRRQVSVEVPGIGRV
2edmA           VDLLINDITVRPTVIAGNIKGNTMSNTYF--SSKDIKSSSSKITLIDVCSGAAFEATMNIGFT-------


                         +         .         .         .         .         *         .:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
1bwzA           YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
3ejxD           AVVEAEGVSWNVTCVSMGNPHCITFGKKGGPLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
3ejxB           AVVEADGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
3ejxA           AVVEADGVSWNVTCVSMGNPHCITFGKKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWE
3ednA           LEVNDLDVSLPIVYGSTGNWTVIVPVKNLD---VCERKPNNEVFPSVLKEIPNASIHPICLETYHFSSAY
2c4mC           G----WEESWAIVSKTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADGLDEETIN
1e4oA           S----WDDAWAITSKTFAYTNHTLMPEALERWDVKLVKGLLPRHMQIINEINTRFKTLVEKTWPGDEKVW
1ahpA           W-----DDAWAITSKTFAYTNHTLMPEALERWDVKLVKGLLPRHMQIINEINTRFKTLV-----------
2ecpA           W-----DDAWAITSKTFAYTNHTLMPEALERWDVKLVKGLLPRHMQIINEINTRFKTLV-----------
2c4mA           EHDMGWEESWAIVSKTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADG-------
2c4mB           G----WEESWAIVSKTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADGLDEETI-
2azpA           SGDIAWGGNWFFLVAGHGQRLAGDNLDALTAYTVAVQQALDDQDIRGEDGGAIDHIELFADDPHADSRNF
2edmA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RXXXXXXXXXXXXXXXXVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
1bwzA           RGAGETQACGSGACAAVAVGIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
3ejxD           RGAGATLACGTGACALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGSALL
3ejxB           RGAGATLACGTGACALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGSALL
3ejxA           RGAGATLACGTGACALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGSALL
3ednA           AGTIEDPVTGTASGVGAYYATYVEKDFDHEELIHKDGRVTVYVTKDVEQIDIAGTAVYVKEFEVLI
2c4mC           R-----------------------------------------------------------------
1e4oA           A-----------------------------------------------------------------
1ahpA           ------------------------------------------------------------------
2ecpA           ------------------------------------------------------------------
2c4mA           ------------------------------------------------------------------
2c4mB           ------------------------------------------------------------------
2azpA           VLCPGKAYDRSPCGTGTS--AKLACLAADGKLLPGQPWRQASDGQPRGRAHVSAEATLLLADDDPF
2edmA           ------------------------------------------------------------------