[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56902.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2btvA.bssp"
#ERROR : Can't open dsspfile "2basB.bssp"
#ERROR : Can't open dsspfile "2basA.bssp"
#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "1b5tB.bssp"
#ERROR : Can't open dsspfile "3cawA.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "3e02A.bssp"
#ERROR : Can't open dsspfile "3btaA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "2ayaA.bssp"
#ERROR : Can't open dsspfile "2a8mB.bssp"
#ERROR : Can't open dsspfile "2bduA.bssp"
#ERROR : Can't open dsspfile "2bjnB.bssp"
#ERROR : Can't open dsspfile "2bw7B.bssp"
#ERROR : Can't open dsspfile "1cjtA.bssp"
#ERROR : Can't open dsspfile "1azsA.bssp"
#ERROR : Can't open dsspfile "1a8rA.bssp"
#ERROR : Can't open dsspfile "3dqqA.bssp"
#ERROR : Can't open dsspfile "3c2wH.bssp"
#ERROR : Can't open dsspfile "2a8jB.bssp"
#ERROR : Can't open dsspfile "2c0jB.bssp"
#ERROR : Can't open dsspfile "3bz1C.bssp"
#ERROR : Can't open dsspfile "2cfhC.bssp"
#ERROR : Can't open dsspfile "2cfhD.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "3c2wD.bssp"
#ERROR : Can't open dsspfile "3c2wA.bssp"
#ERROR : Can't open dsspfile "3c2wB.bssp"
#ERROR : Can't open dsspfile "3c2wE.bssp"
#ERROR : Can't open dsspfile "3c2wC.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "1drmA.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "2a24B.bssp"
#ERROR : Can't open dsspfile "3bwlD.bssp"
#ERROR : Can't open dsspfile "2d01A.bssp"
#ERROR : Can't open dsspfile "1dp8A.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "3bwlB.bssp"
#ERROR : Can't open dsspfile "3eehA.bssp"
#ERROR : Can't open dsspfile "2cmnA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "3bwlA.bssp"
#ERROR : Can't open dsspfile "3b33A.bssp"
#ERROR : Can't open dsspfile "3c2wF.bssp"
#ERROR : Can't open dsspfile "3bwlC.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "2d02A.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "3c2wG.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "1be1A.bssp"
#ERROR : Can't open dsspfile "2b02A.bssp"
#ERROR : Can't open dsspfile "3bs2A.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "3dqqB.bssp"
#ERROR : Can't open dsspfile "2dkyA.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3caxA.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1b1aA.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "2b4aA.bssp"
#ERROR : Can't open dsspfile "2a24A.bssp"
#ERROR : Can't open dsspfile "1ccwA.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"

## Summary of PDB Search
:696
    1e-44   8%  2btvA  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
    6e-38  21%  2basB  [x.x.x] YKUI PROTEIN
    4e-35  21%  2basA  [x.x.x] YKUI PROTEIN
    2e-30   9%  1b5tA  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    3e-26   8%  1b5tB  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    1e-22  13%  3cawA  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    3e-21  20%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    2e-20   8%  3e02A  [x.x.x] UNCHARACTERIZED PROTEIN DUF849
    3e-20   8%  3btaA  [d.92.1 - h.4.2 - b.29.1 - b.42.4] PROTEIN (BOTULINUM
    4e-20  18%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    2e-18   7%  2ayaA  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    7e-18   5%  2a8mB  [x.x.x] THREONINE ASPARTASE 1
    2e-16   9%  2bduA  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    9e-16   9%  2bjnB  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    2e-15  10%  2bw7B  [x.x.x] ADENYLATE CYCLASE
    2e-15  11%  1cjtA  [d.58.29] ADENYLATE CYCLASE, TYPE V
    3e-15  11%  1azsA  [d.58.29] VC1
    5e-15   6%  1a8rA  [d.96.1] GTP CYCLOHYDROLASE I
    1e-14   9%  3dqqA  [x.x.x] PUTATIVE TRNA SYNTHASE
    4e-14   9%  3c2wH  [x.x.x] BACTERIOPHYTOCHROME
    1e-13   7%  2a8jB  [x.x.x] THREONINE ASPARTASE 1
    8e-13  12%  2c0jB  [x.x.x] R32611_2
    2e-12   5%  3bz1C  [x.x.x] PHOTOSYSTEM II CP43 PROTEIN
    2e-12  14%  2cfhC  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    4e-11  14%  2cfhD  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    1e-10  23%  1d06A  [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    5e-10  10%  3c2wD  [x.x.x] BACTERIOPHYTOCHROME
    7e-10   9%  3c2wA  [x.x.x] BACTERIOPHYTOCHROME
    2e-09  11%  3c2wB  [x.x.x] BACTERIOPHYTOCHROME
    6e-09  11%  3c2wE  [x.x.x] BACTERIOPHYTOCHROME
    6e-09  11%  3c2wC  [x.x.x] BACTERIOPHYTOCHROME
    9e-09  11%  1d7eA  [d.110.3] PHOTOACTIVE YELLOW PROTEIN
    5e-08  20%  1drmA  [d.110.3] SENSOR PROTEIN FIXL
    5e-08  12%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    6e-08  13%  2a24B  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    1e-07  22%  3bwlD  [x.x.x] SENSOR PROTEIN
    2e-07  11%  2d01A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    2e-07  20%  1dp8A  [d.110.3] FIXL PROTEIN
    4e-07  19%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    5e-07  19%  3bwlB  [x.x.x] SENSOR PROTEIN
    5e-07  19%  3eehA  [x.x.x] PUTATIVE LIGHT AND REDOX SENSING HISTIDINE
    7e-07  20%  2cmnA  [x.x.x] SENSOR PROTEIN FIXL
    8e-07  13%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    8e-07  17%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    1e-06  21%  3bwlA  [x.x.x] SENSOR PROTEIN
    1e-06  18%  3b33A  [x.x.x] SENSOR PROTEIN
    1e-06   9%  3c2wF  [x.x.x] BACTERIOPHYTOCHROME
    2e-06  21%  3bwlC  [x.x.x] SENSOR PROTEIN
    2e-06  17%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-06  17%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    4e-06  11%  2d02A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    4e-06  22%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    5e-06  16%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    6e-06  12%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    6e-06  12%  3c2wG  [x.x.x] BACTERIOPHYTOCHROME
    8e-06  13%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    1e-05  13%  1be1A  [c.23.6 (1fmfA)] GLUTAMATE MUTASE
    2e-05  14%  2b02A  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    2e-05  10%  3bs2A  [x.x.x] LIPOCALIN
    2e-05  10%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-05  20%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-05  17%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    3e-05  12%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    4e-05  14%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    4e-05  15%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-05  24%  3dgfC  [x.x.x] RESPONSE REGULATOR
    4e-05  23%  3dgeC  [x.x.x] RESPONSE REGULATOR
    5e-05  22%  1bywA  [d.110.3] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    5e-05  15%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    5e-05  14%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    5e-05  19%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    7e-05  17%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    7e-05  10%  3dqqB  [x.x.x] PUTATIVE TRNA SYNTHASE
    8e-05  17%  2dkyA  [x.x.x] RHO-GTPASE-ACTIVATING PROTEIN 7
    9e-05  18%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    1e-04  11%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    1e-04  11%  3caxA  [x.x.x] UNCHARACTERIZED PROTEIN PF0695
    2e-04  20%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-04  16%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-04  19%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    3e-04  13%  1b1aA  [x.x.x] GLUTAMATE MUTASE
    3e-04  20%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    4e-04  17%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-04  14%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    7e-04  18%  1dcfA  [c.23.1] ETR1 PROTEIN
    8e-04  19%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    8e-04  14%  2b4aA  [x.x.x] BH3024
    0.001  13%  2a24A  [x.x.x] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    0.001  15%  1ccwA  [c.23.6] PROTEIN (GLUTAMATE MUTASE)
    0.001  14%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
:696

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCAAMLPQFSVAR
2btvA           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3e02A           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
2ayaA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           --------KIGVIADDFTGATDIASFLVENGM--PTVQINDVPTGTQPEGCDAVVISKTRSCPAQEAIKQ
3c2wH           ----------------------------------------------------------------------
2a8jB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           -------IKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLA
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           --------RVLLVEDSTSLAILYKQYVKDEPYDIFH--VETGRDAIQFIERSKPQLIILDLKLPDMSGED
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           -------LRILIVDDEKLTRDGLIANINWKALSFDIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIE
3c97A           -------LSVLIAEDNDICRLVAAKALEKCTNDITV--VTNGLQALQAYQNRQFDVIIMDIQMPVMDGLE
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           --------RIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIE
3cz5C           --------RIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIE
2d02A           ----------------------------------------------------------------------
1b00A           --------RILVVEDEAPIREMVCFVLEQNGFQPVE--AEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQ
3b2nA           --------SLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLE
1e1cA           --------RILLAKMGQDGQKVIATAYADLGFDVDGPLFQTPEETARQAVEADVHVVGVSSLAGGLTLVP
3c2wG           ----------------------------------------------------------------------
3cu5B           -------LRILIVDDEKLTRDGLIANINWKALSFDIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIE
1be1A           MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCK
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ------------MSYSAKFASCFYGPFRDAARRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMP-YL
3cz5A           --------RIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIE
1dc7A           --------IVWVVDDDSSIRWVLERALAGAGLTCTT--FENGNEVLAALASKTPDVLLSDIRMPGMDGLA
1bmtA           --------ATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPEKILRTAKEVNADLIGLSGLITPSLDEM
3cnbC           --------SILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFS
1d4zA           --------KFLVVDDFSTMRRIVRNLLKELGFNN-VEEAEDGVDALNKLQAGGYGFVISDWNMPNMDLEL
3dgfC           --------KVLLVDDSAVLRKIVSFNLKKEGYEVIE--AENGQIALEKLSEFTPDLIVLDIMMPVMDGFT
3dgeC           --------KVLLVDDSAVLRKIVSFNLKKEGYEVIE--AENGQIALEKLSEFTPDLIVLDIMMPVMDFTV
1bywA           ----------------------------------------------------------------------
3cg0B           --------GVLIVEDGRLAAATLRIQLESLGYDVLGV-FDNGEEAVRCAPDLRPDIALVDIMLCGALDGV
3cg0A           --------GVLIVEDGRLAAATLRIQLESLGYDVLGV-FDNGEEAVRCAPDLRPDIALVDIMLCGALDGV
1d5wB           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKMHQS---AEAFLAFAPDVRNGVLVTLRMPDMSGVE
2ayzA           --------MILVVDDHPINRRLLADQLGSLGYQCKT--ANDGVDALNVLSKNHIDIVLSDVNMPNMDGYR
3dqqB           --------KIGVIADDFTGATDIASFLVENGM--PTVQINDVPTGTQPEGCDAVVISLKTRSCPAQEAIK
2dkyA           ----------------------------------------------------------------------
3crnA           --------RILIVDDDTAILDSTKQILEFEGYEVEI--AATAGEGLAKIENEFFNLALFIKLPDEGT---
3cwoX           ------------------------------------------REAVEKYKELKPDIVTMDITMPEMNGID
3caxA           ----------------------------------------------------------------------
1dcmA           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKM--HQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVE
1c4wA           --------KFLVVDDFSTMRRIVRNLLKELGFNNVE--EAEDGVDALNKLQAGGYGFVISWNMPNMDGLE
1d5wA           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKM---HQSAEAFLAFAPDVRNGVLVTLRMPDMSGVE
1b1aA           MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCK
1dbwA           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKM--HQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVE
3c3wB           -------VKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIE
3cnbA           --------SILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFS
1dcfA           --------KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIAL
1dbwB           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKM--HQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVE
2b4aA           -------FRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSG-SAFFQHRSQLSTCDLLIVSDQLVDLSIFS
2a24A           ----------------------------------------------------------------------
1ccwA           MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVIGVLSPQELFIKAAIETKADAILVSSLYGQGEIDC
1dc8A           --------IVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLA---ALASKTPDVLLSIRMPGMDGLA


                         .         .         *         .         .         .         .:140
query           AAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
2btvA           ---------------------------------------------QILDDIKALAAEQVYKIVKVPSTSF
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3e02A           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3breB           -----------------------------------------------------------QAMIGEAVRRS
2ayaA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           SLAALVWLKKQGCQQVYFKYCSTFDSTAEGNIGPVTDALMVALDTSFTVISPALPVNGRTVYQGYLFVMN
3c2wH           -------------------------------------------------------------------TLA
2a8jB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           ---------------------------------------------------------------AMTFLIR
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           --------------------------------------------------------------HMLETEDV
3c2wD           -------------------------------------------------------------------TLA
3c2wA           ----------------------------------------------------------------------
3c2wB           -------------------------------------------------------------------TLA
3c2wE           -------------------------------------------------------------------TLA
3c2wC           ----------------------------------------------------------------------
1d7eA           ---------------------------------------------------------------AFGSEDI
1drmA           ----------------------------------------------------------------------
1dz3A           VLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKFDMENLAHHIRQVY---------------
2a24B           ----------------------------------------------------------------------
3bwlD           ---------------------------------------------------------------RKRREKR
2d01A           -------------------------------------------------------------HVAFGSEDI
1dp8A           ----------------------------------------------------------------------
3cfyA           VLDWINQNDIPTSVIIATA-HGSVDLAVNLIQKGAEDFLEKINADRLKTSVALHLKRAKLEDLVE-----
3bwlB           ---------------------------------------------------------------RKRREKR
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           LVDNILKLYPDCSVIFM-------SGYSDKEYLRAIRYVEKIDPSEIMDALKQSIQTVLQHQAQQ-----
3c97A           AVSEIRNYERTHNTKRASIIAITADTIDDRPGAELDEYVSKLNPNQLRDVVLTCH---------------
3bwlA           ---------------------------------------------------------------RKRREKR
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ATRHIRQWDGAAR-ILIFTMHQGSAFALKAFEAGASGYVTK--SSDPAELVQA-IEAILAGRRAMSPDIA
3cz5C           ATRHIRQWDGAARILIFTM-HQGSAFALKAFEAGASGYVTK--SSDPAELVQA-IEAILAGRRAMSPDIA
2d02A           ---------------------------------------------------------------AFGSEDI
1b00A           FIKHLKRESMTRIPVVMLTARGEEEDRVRGLETGADDYITKFSPKELVARIKAVMR--------------
3b2nA           VLAEIRKKHLNIKVIIVTT-FKRPGYFEKAVVNDVDAYVLKRSIEELVETINK-----------------
1e1cA           ALRKELDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTP--GTVIPESAISLVKKLRASL--------
3c2wG           ----------------------------------------------------------------------
3cu5B           LVDNILKLYPDCS-VIFMSGYSDKEYLKAAIKFRAIRYVEKIDPSEIMDALKQSIQTVLQHQAQ------
1be1A           GLREKCDEAGLKGIKLFVGGQNWPDVEQRFKAMGFDRVYPPTSPETTIADMKEVLG--------------
2b02A           ----------------------------------------------------------------------
3bs2A           --------------------------------------------------FNDAAQTATYTYGNLGSG--
1e51B           DIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAA--VLEAMTAFRRAGADIIITYYTP-----
3cz5A           ATRHIRQWDGAAR-ILIFTMHQGSAFALKAFEAGASGYVTKSDPAELVQAIEAILAGRRAMSPDIAQEIA
1dc7A           LLKQIKQRHPMLPVIIMTA-HSDLDAAVSAYQQGAFDYLPKFDIDEAVALVERAIS--------------
1bmtA           VNVAKEMERQGFTIGGATTSKAHTAVKIEQNYSGPTVYVQN--ASRTVGVVAALLSDTQRDDFVARTRKE
3cnbC           ICHRIKSTPATANIVIAMTGALTDDNVSRIVALGAETCFGKLNFTLLEKTIKQLVE--------------
1d4zA           LKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKFTAATLEEKLNKIFE--------------
3dgfC           VLKKLQEKEEWKRIVIVLTAKGGEEDESLALSLGARKVMRKFSPSQFIEEVKHLL---------------
3dgeC           LKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKFSPSQFIEEVKHLLNE-------------
1bywA           ----------------------------------------------------------------------
3cg0B           ETAARLAAGCNLP-IIFITSSQDVETFQRAKRVNPFGYLAK--PVAADTLHRSIEMAIHKKKLE------
3cg0A           ETAARLAAGCNLPIIFITS-SQDVETFQRAKRVNPFGYLAK--PVAADTLHRSIEMAIHKKKLE------
1d5wB           LLRNLGDLKINIPSIVITG-HGDVPMAVEAMKAGAVDFIEKFEDTVIIEAIERASE--------------
2ayzA           LTQRIRQLGLTLPVIGVTA-NALAEEKQRCLESGMDSCLSK--PVTLDVIKQTLTLYAERVRKSRDS---
3dqqB           QSLAALVWLKKQGCQVYFKYCSTFDSTAEGNIGPVTDALMVALDTSFTVISPALPVNGRTVYQGYLFVMN
2dkyA           ----------------------------------------------------------------------
3crnA           --ELLEKAHKLRPGKKIVTGYASLENSVFSLNAGADAYIKPVNPRDLLEKIKEKLDEQEKEGHHHH----
3cwoX           AIKEIMKIDPNA-KIIVCSAMGQQAMVIEAIKAGAKDFIVNAAVENPSLITQIAQTFGSQAVVVAIDAKR
3caxA           ----------------------------------------------------------------------
1dcmA           LLRNLGDLKINIPSIVITG-HGDVPMAVEAMKAGAVDFIEKFEDTVIIEAIERASE--------------
1c4wA           LLKTIRADGAMSALVLMVTAEAKKENIIAAAQAGASGYVVKFTAATLEEKLNKIFE--------------
1d5wA           LLRNLGDLKINIPSIVITG-HGDVPMAVEAMKAGAVDFIEKFEDTVIIEAIERASE--------------
1b1aA           GLRQKCDEAGLEGILLVVGKQHWPDVEKRFKDMGYDRVYAPTPPEVGIADLKKDLN--------------
1dbwA           LLRNLGDLKINIPSIVITG-HGDVPMAVEAMKAGAVDFIEKFEDTVIIEAIERASE--------------
3c3wB           LCRDLLSRMPDLR-CLILTSYTSDEAMLDAILAGASGYVVKIKGMELARAVKDVGA--------------
3cnbA           ICHRIKSTPATANIIVIAMGALTDDNVSRIVALGAETCFGKLNFTLLEKTIKQLV-----EQKK------
1dcfA           RIHEKFTQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLK--PVSLDNIRDVLSDLLEPRVLY------
1dbwB           LLRNLGDLKINIPSIVITGHGDVPMAV-EAMKAGAVDFIEKFEDTVIIEAIERASE--------------
2b4aA           LLDIVKEQTKQPSVLIL------TTGRLIESSEHNLSYLQKFAISELRAAIDYHK---------------
2a24A           ----------------------------------------------------------------------
1ccwA           KGLRQKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPTPPEVGIADLKKDLN--------------
1dc8A           LLKQIKQRHPMLPVIIMTA-HSDLDAAVSAYQQGAFDYLPKFDIDEAVALVERAIS--------------


                         +         .         .         .         .         *         .:210
query           LGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEY
2btvA           RHIVTQSRDRVLRVDTYYEEMSQVGDVITEDEPEKFYSTIIKKVRFIRGKGSFILHDIPARDHRGMEVAE
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
3breA           ----------------------QQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLS
3e02A           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3breB           LASEAGIDFHFCSDPQQAVAVANQITVILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKS
2ayaA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bduA           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           HLLAEYLPRLMEAQAQGRCGVIPAQTLDEGVAATRAALSRLQQEGYR-YAVLDALNERHLEIQGEVLRDA
3c2wH           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLTGNG
2a8jB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           DQKLGANVGSAQGPTGLGKYLMSPTGEIIFGGETMRFWDFRG-PWLEPLRGPNGLDLNKIKNERRAAEYM
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           VRARDAHLRSILDTVPDATVVSTDGTIVSFNAAAVRQFGYAE-EEVIGQNLRILMPEPYRHEHDGYLQRT
3c2wD           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLTGN-
3c2wA           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLT---
3c2wB           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLTG--
3c2wE           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLTGNG
3c2wC           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVG----PEVLRMLEEGL
1d7eA           ENTLAKMDDGQLDGLAFGAIQLGDGNILQYNAAEGDITGRDP-KQVIGKNFFKDVAPCTDSPEFYGKFKE
1drmA           -----------------------HGIIQLFSTAAERLFGWSE-LEAIGQNVNILMPEPDRSRHDSYISRY
1dz3A           ----------------------------------------------------------------------
2a24B           -----------------------EGIFTFVDHRCVATVGYQP-QELLGKNIVEFCHPEDQQLLRDSFQQV
3bwlD           LEETSSRLEALFENSPDIDVLDADGTICEVNQRFCAELGYDE-SEVLGRSIWEFDLFDAEDVQTQLSG--
2d01A           ENTLAKMDDGQLDGLAFGAIQLGDGNILQYNAAEGDITGRDP-KQVIGKNFFKDVAPCTDSPEFYGKFKE
1dp8A           -----------------------HGIIQLFSTAAERLFGWSE-LEAIGQNVNILMPEPDRSRHDSYISRY
3cfyA           ----------------------------------------------------------------------
3bwlB           LEETSSRLEAL-FENSPDIDVLADGTICEVNQRFCAELGYDE-SEVLGRSIWEFDLFDAEDVQTQLSG--
3eehA           ----ERRVRELTEATNDILWEFDLSEVLVINSAYEDIWGRSV-AKLRENPHDFLNGIHPEDRELMKDTMQ
2cmnA           -----------------------HGIIQLFSTAAERLFGWSE-LEAIGQNVNILMPEPDRSRHDSYISAY
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           LEETSSRLEALFENSPDIDVLDADGTICEVNQRFCAELGYDE-SEVLGRSIWEFDLFDAEDVQTQLSG--
3b33A           --------PSAILNNVTATLILDGLAIRYANPAAELLFSQSA-KRIVEQSLSQLIQHASL--DLALLTQP
3c2wF           NCEDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPGSYLTQEQVGPEVLRMLEEGLTGNG
3bwlC           LEETSSRLEALFENSPDIDVLDADGTICEVNQRFCAELGYDE-SEVLGRSIWEFDLFDAEDVQTQLSG--
3cz5B           QEIAEERV--------------------------------------------------------------
3cz5C           QEIAEERVEG------------------------------------------------------------
2d02A           ENTLAKMDDGQLDGLAFGAIQLGDGNILQYNAAEGDITGQDP-KQVIGKNFFKDVAPCTDSPEFYGKFKE
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           NCEDEPIHVPGAIQPHGALVTLRDGMVLAASENIQALLGFVASPGS-YLTQEQVGPEVLRMLEEGLTGNG
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ---------SNVSQPTEFI-SRHEGIFTFVDHRCVATVGYQP-QELLGKNIVEFCHPEDQQLLRDSFQQV
3bs2A           --NQLTQQTASASISGNAIVVGTDHSEVYSDGSTCDVVRL-NGQIELWIHSSATSNTGNLNSCCTDKFNQ
1e51B           ----------------------------------------------------------------------
3cz5A           E---------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           YETVRIQHG-------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ---------------------------IYCNDGFCELCGYSR-AEVMQRPCCDFLHGPCTQRRAAAQIAQ
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           HLLAESGMRHHPINPMTDSYLPRLMEAQAQGRCGVIPAQTLDEGVAATRAALSRLALNERHLEIQGEVLR
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           VDGEFMVFTYSGKKNTG-----------------------------------------------------
3caxA           -----------------------EGHPLKTLYQENKEIMK-DAEMLNLYATLATTKDERMREILGVLEE-
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ---------------KTFLSRHMDMKFTYCDDRITELIGYHP-EELLGRSAYEFYHALDSENMTK-SHQN
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GASEGKSAHFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILTGFFS
2btvA           PEVLGVEFKNVLPVLTAEHRAMIQNALDGSIIENGNVATRDVDVFIG------------------ACSEP
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3cawA           -----------LKVEWNDGLYGFADLHPWPELGDLSLEEQLSDLRMGRMTTQIEQSIWLARRDALLRKEK
3breA           TKEEPTVKSAAFAAGANDYLVKLPDAIELVALQQRDEAYRALRESQQQLLETNLVLQRLMNSDGLTGLSN
3e02A           ----------------------------------------------------------------------
3btaA           -----------FKIHNKIWVIPERDTFTNPEEGDLNPPPEAKPVSYYDSTYLSTDNEKDNYLKGVTKLFE
3breB           AAFAAGANDYLVKLPDAIELVARIRYHSRSYIALQQRDEAYLRESQQQLLETNLVLQRLMNSDGLTGLSN
2ayaA           ----------------------------------------------------------------------
2a8mB           --------FTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVALSGIKNPVSVANRLLCEGQKGKLSRIPP
2bduA           ----------------------------------------------------------------------
2bjnB           ------------------------------------------------------------------SMAD
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------LSKEAA
3dqqA           PLVTGGSARQWAKHGVSRSAGYPLSGRAVVLSGSC-----SQMTNQQVAFYRQHAPTRDVDVARCLSSET
3c2wH           PWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTADTL--SITSFTLNAQRIIAQVQLHNDTASLLSNVT
2a8jB           ------------------------------------------LSGIKNPVSVANRLLCEGQKGKLSRIPP
2c0jB           ----------------------------------------------------------------------
3bz1C           THAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHRAAAAGFEKGIDRESEP--------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           GEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT-----------------------
3c2wD           ---GPWSNSVETRIGEHLFDVIGHSYKEVF----------------------------------------
3c2wA           ---GNGPWSNSVETRIGEHLFDVIGHSYKEVFYEIRTADTLSITSFTLNAQRIIAQVQLHNDTASLLSNV
3c2wB           NGPWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIAQVQLHNDTASLLSNVT
3c2wE           PWSNSVETRIGEHLFDVIGHSYKEVFYLE-----------------------------------------
3c2wC           TGNGPWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTADTLTSFTLNAQRIIAQVQLHNDTASLLSNVT
1d7eA           GVASGNLNTMFEYTFDYQMTPTK--VKVHMKKALSYWV--------------------------------
1drmA           SDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ----------
1dz3A           ----------------------------------------------------------------------
2a24B           VKLKGQVLSVMFRFRSKNQEWLWMRTSSFT----------------------------------------
3bwlD           -FSVDERRKFEGLYERRDGSTS---VEVHLLRFNLEGEDRFLSRD-------------------------
2d01A           GVASGNLNTMFEYTFDYQMTPTKVKVHMKK----------------------------------------
1dp8A           SDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ----------
3cfyA           ----------------------------------------------------------------------
3bwlB           -FSVDERRKFEGLYERRDG-STSVEVHLLRFNLEGEDRFLAISRD-------------------------
3eehA           SLMDGESADVECRVNATEEYQRWVWIQGEPITNDAGETVRVAARDIT-----------------------
2cmnA           RTTSIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ----------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           -FSVDERRKFEGLYERRDG-STSVEVHLLRFNLEGEDRFLAISRD-------------------------
3b33A           LQSGQSITDSDVTFVVDGRPL----LEVTVSPITWQRQLLLVERK-------------------------
3c2wF           PWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTTLSITSFTLNAQRIIAQVQLHNDTASLLSNVTDELR
3bwlC           -FSVDERRKFEGLYERRDG-STSVEVHLLRFNLEGEDRFLAISRD-------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           GVASGNLNTMFEYTFDYQMTPTKVKVHMKK----------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           PWSNSVETRIGEHLFDVIGHSYKEVF--------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           -VKLKGQVLSVFRFRSKNQEWLWRTSSFTF----------------------------------------
3bs2A           -EKGSRPEHVVYRSTCPNL---------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ALLGAEERKVEIAFYRKDGSCFLCLVDVVP----------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           DAPLVTGGSGLAMGLARQWAKSAGYPLSGRAVVLSGSCSQMTNQQVAFYRQH--APTRDVDVARCLSSET
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           -IVSSLRMVGFTHYNREEMLIFPYIERRGLTVIATVLWTK------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           LCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPNLQPQCIMNYVLS-----------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
2btvA           IYRIYNRLQGYIEAVQLQELRNSIGWLERKRITYSQEVLTDFRRQDMIWVLALQLPVNPQVVWDVPRSSI
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           ----------------------------------------------------------------------
1b5tB           ----------------------------------------------------------------------
3cawA           KHVFDGGEKIKNNYLLSHFQDLFLDGLKNEGYNTVKVKMGQKEADMLTHIAASGMRMRLDFNALGSWQTF
3breA           RRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSLAARYGG
3e02A           ----------------------------------------------------------------------
3btaA           RIYSTDLGRMLL--TSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFE
3breB           RRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSDLAARYGG
2ayaA           ----------------------------------------------------------------------
2a8mB           CFLVGEGAYRWAVDHGIPSCSVGAVVVDHEGVAAAPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCG
2bduA           ----------------------------------------------------------------------
2bjnB           EALFLLLHNEMVSGVY---KSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICK
2bw7B           -------------------RLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENGTVDKFVG
1cjtA           ------MMFHKI--YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAEHCLRIKILG
1azsA           --------------YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAEHCLRIKILG
1a8rA           LVLVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGLDYA
3dqqA           REAYAEALAQWVLSQDSELAPMISATASTQALAAIQQQYGATEASHAVEALFSLLAARLAEGGIFIVAGG
3c2wH           DELRRMTGYDRVMAYRF-RHDDSGEVVAESRREDLESYLGQRYPASDIPAQARRLYIQNPIRLIADVAYT
2a8jB           CFLVGEGAYR----WAVDHGIPSCTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWASGCG
2c0jB           ----------------------EMVAELWKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCK
3bz1C           ----------------------------------------------------------------------
2cfhC           ----------------------SGVYKSAEQGEVELENMGFRVGQGLIERFTKDTARFKDELDIMKFICK
2cfhD           ----------------------SGVYKSAEQGEVELENMGFRVGQGLIERFTKDTARFKDELDIMKFICK
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           TDELRRMTGYDRVMAYRFRHDDSGEVVAESRREDLESYLGQRYPASDIPAQARRLYIQNPIRLIADVAYT
3c2wB           DELRRMTGYDRVMAYRFRHDDSGE----------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           DELRRMTGYDRVMAYRFRHDDSGEVVAESRREDLESYLGQRYPASDIPAQARRLYIQNPIRLIADVAYTP
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           RMTGYDRVMAY-----------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           REAYAEALAQWVLSQDSELAPMISATASTQALAAIQQQYGATEASHAVEALFSLLAARLAEGGITRFIV-
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
2btvA           ANLIMNIATCLPTGEYIAPNP----------RISSITLTQRITTTGPFAILTGST-PTAQQLNDVRKIYL
2basB           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
1b5tA           -----------------------------------------INVSFEFFPPRTSEMEQTLWNSIDRLSSL
1b5tB           ----------------------------------------------------------------------
3cawA           EKFMVNLPLTVRPLIEYVEDPFPFDFHAWGEARVPWGKIASAPFDVIVI-------KPAKTDVDKAVAQC
3breA           EEFAMVLPGTSPGGARLLAEKVRRTVEQISHDQPRPGSHLTVSIGVSTLVPGGGGQRVLIEMADQALYQA
3e02A           ----------------------------------------------------------------------
3btaA           CKSFGHEVLNLTRNGGSTQYIRFSP-DFTFGFEESLEVDTNPLLGAG-----------------------
3breB           EEFAMVLPGTSPGGARLLAEKVRRTVESLSHDQPRPGSHLTVSIGVSTLVPGGGGQRVLIEMADQALYQA
2ayaA           ----------------------------------------------------------------------
2a8mB           EHLVRTILARECSHALQAEDAHQALLETMQNKFISEDGVLGGVIVLRSCRCQTLLVEFLWSHTTESMCVG
2bduA           ----------------------------------------------------------------------
2bjnB           DFWTTVFKKQIDNLRTHQGIYVLQDNKFRLLTHASKYLAFTCGLIRGGLSNLGIKSTAEVSSMPACKFQV
2bw7B           DAIMALYGAPEEMSPSEQVRRAIATARQMLVALEK---LNQGWQERGLVGRPPVRFRCGIHQGMAVVGLF
1cjtA           DCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVRENMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLAN
1azsA           DCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVRENMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLAN
1a8rA           NFPKITLI----ENKMKVDEMVTVRDITLTSTCESHFVTIDGKATVAYIPKDSV--IGLSKINRIVQFFA
3dqqA           ETSGVVTQSLGITGFHIGPCISPGVPWVNAL---HAPVSLALKSGNFGDESF------FIRAQREF----
3c2wH           PMRVFPALNPETNESFDLSYSVLRSVSPI-HCEYLTNMGVRASMSISIVVGGKLWGLFSCHHMSPKLIPY
2a8jB           EHLVRTILARECSHALQAEDAHQALLETMQNKFISSDGVLGGVIVLRSCRCQTLLVEFLWSHTTESMCVG
2c0jB           DLWVAVFQKQMDQGTYVLQDNSFPLLLGL-QYLEEAPKFLAFTCGLLRGALYTLGIESVV-TASVAALPV
3bz1C           ----------------------------------------------------------------------
2cfhC           DFWTTVFKKQIDNLRNHQGIYVLQDNKFRLLYLEHASKYLAFTCGLIRGGLSNLGITAEVSSMPACKFQV
2cfhD           DFWTTVFKKQIDNLRNHQGIYVLQDNKFRLLTQEHASKYLAFTCGLIRGGLSNLGIKAEVSSMPACKFQV
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           PMRVFPALNPETNESFDLSYSVLRSVSPIHCEYLTNMGVRASMSISIVVGG---KLWGLFSCHHMSPKLI
3c2wB           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           MRVFPALNPETNESFDLSYSVLRSVSPIHCEYLTNMGVRASMSISIVVGGK-------------------
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           --------AGGETSGVVTQS-LGITGFHIGPCIS------------------------------------
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
2btvA           ALMFPGQIILDLK------IDPGERMDPAVRMVAGVVGH-LLFTAGGRFTNL-----------TQNMARQ
2basB           -----------------------------PLDILTNI-DDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
2basA           ------------------------------LDILTNI-DDVLPYYQAIFSAEEQKVVGYEVLGRILADSE
1b5tA           KPKFVSVTYGANS----------GERDRTHSIIKGIKDR-TGLEAAPHLTCIDATPDELRTIARDYW---
1b5tB           --------------------------LKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDA
3cawA           KWNLKLAVTSYMGVVHAVGVAMELKD---KYGDMILE-SGCLTHRLYQMDSFAELSTQGPYLLKNKGTGV
3breA           KNNGRNQVGLME----------------------------------------------------------
3e02A           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3breB           KNNGRNQVGLME----------------------------------------------------------
2ayaA           -----------------------------------------------------------KALEHEKTPEL
2a8mB           YMSAQDGKAKTHISRLPPGAVA---GQSVAIEGGV-----------------------------------
2bduA           ------------------------------------NPTRVEEIICGLIKGGAAKLQIITDFDTLSRFSY
2bjnB           MI--------------------------------------------------------------------
2bw7B           GSQERSDFTAIGPSLQEATAPNSI-MVSAMVAQYVP---DEEIIKREFLELKGIDEMTCVINPNM-----
1cjtA           HMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERN----AYLKEHSIE---------------------
1azsA           HMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERN----AYLKEHSIE---------------------
1a8rA           QRPQVQ----------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
3c2wH           PVRMSFQIFSQVCSAIVERLEQGRIAELLR----------------------------------------
2a8jB           YMSAQDGKAKTHISRLPPGAVA---GQSVAIEGGV-----------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           PYPVRMSFQIFSQVCSAIVERLEQGRIAELLRVSTERR-------LALARRARDADDLFGALAHPDDGIA
3c2wB           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
2btvA           LDIALNDYLLYMYNTRVQVNYGPTGEPLDFQIGRNQYDCNVFGYNGWATIDVEYRDPAPYVHAQRYIRYC
2basB           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALDRFLEADSDL---LIFNQDANLLLDHGESFLELLKEYEAK
2basA           IQSLGPFFLDAGIPEEYKLEVDNRIIRQALDRFLEADSDL---LIFNQDANLLLDHGESFLELLKEYEAK
1b5tA           ----NNGIRHIVALRGDLPPGSGKPEMYASDLVTLLKEVAD---FDISVAAYPEVHPEAKSAQADLLNLK
1b5tB           TPDELRTIARDYWNNGIRHIVARGDLPPGSGKPEMYASLKEVADFDISVAAYPEVHPEAKSAQADLLNLK
3cawA           GF---DKLLE------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3e02A           --PDLFRFLPQLKRTDAILNITTGGGLGSLDERLAPARAARPE--VASNGSLNFNISQAAAKFDTF----
3btaA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
2ayaA           AAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSML
2a8mB           ----------------------------------------------------------------------
2bduA           NGKRCPTCHNIIDNCKLVTDECRRKLLQLK------EQYYAIEVDPVLTVEEKFPYVEWYTKSHGLLIEQ
2bjnB           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
2a8jB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           ALIPCDGLVMLGGRTLSIRGDFERQAGNVLQRLQRDP---------------------------------
3c2wB           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
2btvA           GIDSRELINPTTYGIGMTYHCYNEML-RMLVAAGKDSEAAYFRSMLPFHMVRFARINQIINEDL-HSVFS
2basB           GIELHRFVLEITEHNFEGD-IEQLYHLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQAL---
2basA           GIELHRFVLEITEHNFEGDIEQLYHL-AYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQAL---
1b5tA           RKVDAGANRAITQFFFD--VESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFDMTNVRIPAWMAQMF
1b5tB           RKVDAGANRAITQF--FFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFDMTNVRIPAWMAQMF
3cawA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3e02A           KFDWERPYLAGTRDFILSNTFSQIERGTELGASGTRFEFECYDVG-HLYNLFVDRKLVEPPFFLQCVFGI
3btaA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
2ayaA           KGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNI-------------------------
2a8mB           ----------------------------------------------------------------------
2bduA           GIPKAKLKEIVADSDVLK--EGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFDF
2bjnB           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
2a8jB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
3bz1C           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
2dkyA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPNQFxxxxxxxxx
2btvA           LPDDMFNALLPDLIAGAHQNADPVVLDVSWISLWFAFNRSFEPTHRNEML----------------
2basB           -KSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSET---------
2basA           -KSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYL---------------
1b5tA           DGLDDDAETRKVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP------------
1b5tB           DGLDDDAETRKVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP------------
3cawA           ------------------------------------------------------------------
3breA           ------------------------------------------------------------------
3e02A           LGGIGADPENLLHRTIAFGQDYYLSVLAAGRHQPFVTSAILGGNVRVGLEDSLY------------
3btaA           ------------------------------------------------------------------
3breB           ------------------------------------------------------------------
2ayaA           ------------------------------------------------------------------
2a8mB           ------------------------------------------------------------------
2bduA           DENGVLKGFKTDYFSQLKDNSNIILLGDSQGDLRADGVANVEHILKIGYLNDRVD-----------
2bjnB           ------------------------------------------------------------------
2bw7B           ------------------------------------------------------------------
1cjtA           ------------------------------------------------------------------
1azsA           ------------------------------------------------------------------
1a8rA           ------------------------------------------------------------------
3dqqA           ------------------------------------------------------------------
3c2wH           ------------------------------------------------------------------
2a8jB           ------------------------------------------------------------------
2c0jB           ------------------------------------------------------------------
3bz1C           ------------------------------------------------------------------
2cfhC           ------------------------------------------------------------------
2cfhD           ------------------------------------------------------------------
1d06A           ------------------------------------------------------------------
3c2wD           ------------------------------------------------------------------
3c2wA           ------------------------------------------------------------------
3c2wB           ------------------------------------------------------------------
3c2wE           ------------------------------------------------------------------
3c2wC           ------------------------------------------------------------------
1d7eA           ------------------------------------------------------------------
1drmA           ------------------------------------------------------------------
1dz3A           ------------------------------------------------------------------
2a24B           ------------------------------------------------------------------
3bwlD           ------------------------------------------------------------------
2d01A           ------------------------------------------------------------------
1dp8A           ------------------------------------------------------------------
3cfyA           ------------------------------------------------------------------
3bwlB           ------------------------------------------------------------------
3eehA           ------------------------------------------------------------------
2cmnA           ------------------------------------------------------------------
3cu5A           ------------------------------------------------------------------
3c97A           ------------------------------------------------------------------
3bwlA           ------------------------------------------------------------------
3b33A           ------------------------------------------------------------------
3c2wF           ------------------------------------------------------------------
3bwlC           ------------------------------------------------------------------
3cz5B           ------------------------------------------------------------------
3cz5C           ------------------------------------------------------------------
2d02A           ------------------------------------------------------------------
1b00A           ------------------------------------------------------------------
3b2nA           ------------------------------------------------------------------
1e1cA           ------------------------------------------------------------------
3c2wG           ------------------------------------------------------------------
3cu5B           ------------------------------------------------------------------
1be1A           ------------------------------------------------------------------
2b02A           ------------------------------------------------------------------
3bs2A           ------------------------------------------------------------------
1e51B           ------------------------------------------------------------------
3cz5A           ------------------------------------------------------------------
1dc7A           ------------------------------------------------------------------
1bmtA           ------------------------------------------------------------------
3cnbC           ------------------------------------------------------------------
1d4zA           ------------------------------------------------------------------
3dgfC           ------------------------------------------------------------------
3dgeC           ------------------------------------------------------------------
1bywA           ------------------------------------------------------------------
3cg0B           ------------------------------------------------------------------
3cg0A           ------------------------------------------------------------------
1d5wB           ------------------------------------------------------------------
2ayzA           ------------------------------------------------------------------
3dqqB           ------------------------------------------------------------------
2dkyA           ------------SSGMCRKKPDTMILTQIEAKEACDWLRATGFPYAQLYEDFLF------------
3crnA           ------------------------------------------------------------------
3cwoX           ------------------------------------------------------------------
3caxA           ------------------------------------------------------------------
1dcmA           ------------------------------------------------------------------
1c4wA           ------------------------------------------------------------------
1d5wA           ------------------------------------------------------------------
1b1aA           ------------------------------------------------------------------
1dbwA           ------------------------------------------------------------------
3c3wB           ------------------------------------------------------------------
3cnbA           ------------------------------------------------------------------
1dcfA           ------------------------------------------------------------------
1dbwB           ------------------------------------------------------------------
2b4aA           ------------------------------------------------------------------
2a24A           ------------------------------------------------------------------
1ccwA           ------------------------------------------------------------------
1dc8A           ------------------------------------------------------------------