[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56915.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bjdC.bssp"
#ERROR : Can't open dsspfile "2dqbC.bssp"
#ERROR : Can't open dsspfile "2dqbE.bssp"
#ERROR : Can't open dsspfile "2dqbB.bssp"
#ERROR : Can't open dsspfile "2dqbD.bssp"
#ERROR : Can't open dsspfile "2dqbA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"

## Summary of PDB Search
:406
    7e-35  17%  3bjdC  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-14  15%  2dqbC  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
    8e-12  13%  2dqbE  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
    9e-11  16%  2dqbB  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
    2e-10  13%  2dqbD  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
    3e-10  14%  2dqbA  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
    3e-07  14%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPG
3bjdC           ---------TRNQLQNLPIEEARIVAVHATSRQIDRQAYAAYQQ---LLYVLSLSDDVATAQTRRWLRAI
2dqbC           ----------------------------------------------------------------------
2dqbE           ----------------------------------------------------------------------
2dqbB           ----------------------------------------------------------------------
2dqbD           ----------------------------------------------------------------------
2dqbA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------QLLYVLSLSDDVATAQTRRWLARI


                         .         .         *         .         .         .         .:140
query           YKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGILRHVSPAFAEDPVRILXXXX
3bjdC           YRVEERFPAADLSEEDFQKRLEQEIAAQS-RERHPSQYVFSGSASRAQLQVF-----LRHQWFRTFRLYR
2dqbC           ----------------------------------------------------------------------
2dqbE           ----------------------------------------------------------------------
2dqbB           ----------------------------------------------------------------------
2dqbD           ----------------------------------------------------------------------
2dqbA           ----------------------------------------------------------------------
3bjdB           YRVEERFPAADLSEEDFQKRLEQEI-AAQSR----ERHPSQ-YVFSGSASRAQLQVFLRHQWFRTFRLYR


                         +         .         .         .         .         *         .:210
query           XXXXXXXKVAPETLALMEAMVTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPEIECL
3bjdC           DAADLLVNDVDEAAALARYL--YGELGEEDEKGSHPRLLAKLLEAIGLEADFQAVSTPEEIAYLNNRARA
2dqbC           ------------------------EASRLAPQKARDTRGRAHPEPESLYRTPYQKDRDRILH-TTAFRRL
2dqbE           -------------------------------QKARDTRGRAHPEPESLYRTPYQKDRDRILH-TTAFRRL
2dqbB           ------------------------EASRLAPQKARDTRGRAHPEPESLYRTPYQKDRDRIL-HTTAFRRL
2dqbD           -----------------------------YAQKARDTRGRAHPEPESLYRTPYQKDRDRILH-TTAFRRL
2dqbA           -----------------------------YAQKARDTRGRAHPEPESLYRTPYQKDRDRILHT-TAFRRL
3bjdB           DAADLLVNLTDVDEAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQAVST-------PEEIAY


                         .         .         .         +         .         .         .:280
query           FGVPQPRRYHPEIDTGIHTLKVLEIAAHLSSDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVALVLT
3bjdC           F-------RHAEVGWGLAVFYITELV--------VNHEKLYRALLQAGLSEDQAEYYKVHISLVPPRAKR
2dqbC           EYKTQVLPGWAYRTRLTHTLEVAQVSRSIANEDLTEAIALSHDLGHPPFGHTQDHGGFEHNAQALRILTH
2dqbE           EYKTQLPGDYYR-TRLTHTLEVAQVSRSIANEDLTEAIALSHDLGHPPFGTGLDHGGFEHNAQALRILTH
2dqbB           EYKTQ---VLPYRTRLTHTLEVAQVSRSIANEDLTEAIALSHDLGHPPFGALQDHGGFEHNAQALRILTH
2dqbD           EYKTQVLPDYYR-TRLTHTLEVAQVSRSIANEDLTEAIALSHDLGHPPFGHTQDHGGFEHNAQALRILTH
2dqbA           EYKTQLPGWAYYRTRLTHTLEVAQVSRSIANEDLTEAIALSHDLGHPPFGHTGEALQDHGGFEHNAQALR
3bjdB           LNNRARAFRHAEVGWGLAVFYITELVHE-------KLYRALLQAGLSEDQAEYYKVHISLVPPRAKREWQ


                         .         *         .         .         .         .         +:350
query           LCQRLRVPKAYQALAVQVARYHNLVHQAQELRPGTILKLLNRVDAFRRPSRxxxxxxxxxxxxxxxxxxx
3bjdC           EWQLIAPDVQFQNAFLTSLSQHFRVERA------------------------------------------
2dqbC           LEVRYPGFRGLNLTYEVLEATHEALYEGQGTLEAQVVDLSDAIAYAAHDLD-------------------
2dqbE           LEVRYPGFRGLYEVLEGIATHEAAPLYEGQGTLAQVVDLSDAIAYAAH----------------------
2dqbB           LEVRYPGFRGLNLTYEVLEGITHEEGQGTLEAQ--VVDLSDAIAYAAH----------------------
2dqbD           LEVRYPGFRGLNLTY-EVLEGIATHYEGQGTLEAQVVDLSDAIAYAAH----------------------
2dqbA           ILTHLEVRYPGFRGLNLTYEVLEGIEAGQGTLEAQVVDLSDAIAYAAHDLD-------------------
3bjdB           LIARRIPDVQFQNAFLTSLSQHFRVERA------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjdC           --------------------------------------------------------
2dqbC           --------------------------------------------------------
2dqbE           --------------------------------------------------------
2dqbB           --------------------------------------------------------
2dqbD           --------------------------------------------------------
2dqbA           --------------------------------------------------------
3bjdB           --------------------------------------------------------