[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA56917.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bxsA.bssp"
#ERROR : Can't open dsspfile "2bhpA.bssp"
#ERROR : Can't open dsspfile "3ek1B.bssp"
#ERROR : Can't open dsspfile "2d4eC.bssp"
#ERROR : Can't open dsspfile "2d4eA.bssp"
#ERROR : Can't open dsspfile "3b4wA.bssp"
#ERROR : Can't open dsspfile "3ek1G.bssp"
#ERROR : Can't open dsspfile "3ek1A.bssp"
#ERROR : Can't open dsspfile "1a4zA.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "3ed6A.bssp"
#ERROR : Can't open dsspfile "1bi9D.bssp"
#ERROR : Can't open dsspfile "1bi9A.bssp"
#ERROR : Can't open dsspfile "2bjaA.bssp"
#ERROR : Can't open dsspfile "3efvA.bssp"
#ERROR : Can't open dsspfile "3efvC.bssp"
#ERROR : Can't open dsspfile "1bi9C.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1bi9B.bssp"
#ERROR : Can't open dsspfile "1co3A.bssp"
#ERROR : Can't open dsspfile "1co3B.bssp"
#ERROR : Can't open dsspfile "1ddqC.bssp"
#ERROR : Can't open dsspfile "3cyvA.bssp"
#ERROR : Can't open dsspfile "3e08A.bssp"
#ERROR : Can't open dsspfile "3dorB.bssp"
#ERROR : Can't open dsspfile "3c3dA.bssp"
#ERROR : Can't open dsspfile "3cgwA.bssp"
#ERROR : Can't open dsspfile "3dorA.bssp"
#ERROR : Can't open dsspfile "3cskA.bssp"
#ERROR : Can't open dsspfile "1e0tA.bssp"
#ERROR : Can't open dsspfile "3c3eA.bssp"
#ERROR : Can't open dsspfile "2c8eG.bssp"
#ERROR : Can't open dsspfile "2cbuA.bssp"
#ERROR : Can't open dsspfile "2cbuB.bssp"
#ERROR : Can't open dsspfile "3cniA.bssp"
#ERROR : Can't open dsspfile "3bjzB.bssp"
#ERROR : Can't open dsspfile "3bjqH.bssp"
#ERROR : Can't open dsspfile "1at3A.bssp"
#ERROR : Can't open dsspfile "3dpmA.bssp"
#ERROR : Can't open dsspfile "3e96A.bssp"
#ERROR : Can't open dsspfile "2cbvA.bssp"
#ERROR : Can't open dsspfile "3ecvD.bssp"
#ERROR : Can't open dsspfile "2e0iA.bssp"

## Summary of PDB Search
:454
    1e-91  31%  1bxsA  [c.82.1] ALDEHYDE DEHYDROGENASE
    1e-91  28%  2bhpA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    2e-91  31%  3ek1B  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-91  32%  2d4eC  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    4e-90  32%  2d4eA  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    3e-89  28%  3b4wA  [x.x.x] ALDEHYDE DEHYDROGENASE[MASQUE : MEMB(X) 46 / COIL(x)
    9e-89  30%  3ek1G  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-88  31%  3ek1A  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-88  30%  1a4zA  [c.82.1] ALDEHYDE DEHYDROGENASE
    4e-86  30%  1a4sA  [c.82.1] BETAINE ALDEHYDE DEHYDROGENASE
    5e-86  27%  3ed6A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    7e-85  29%  1bi9D  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    2e-82  30%  1bi9A  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    5e-82  27%  2bjaA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    5e-81  44%  3efvA  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    7e-81  44%  3efvC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    1e-80  29%  1bi9C  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    4e-78  24%  1ad3A  [c.82.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    1e-77  30%  1bi9B  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    1e-73  19%  1co3A  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-72  19%  1co3B  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-48  11%  1ddqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    2e-46  10%  3cyvA  [x.x.x] UROPORPHYRINOGEN DECARBOXYLASE
    2e-45  13%  3e08A  [x.x.x] TRYPTOPHAN 2,3-DIOXYGENASE
    2e-45  11%  3dorB  [x.x.x] PROTEIN CT_858
    6e-44   8%  3c3dA  [x.x.x] 2-PHOSPHO-L-LACTATE TRANSFERASE
    3e-42   8%  3cgwA  [x.x.x] LPPG:FO 2-PHOSPHO-L-LACTATE TRANSFERASE
    5e-42   9%  3dorA  [x.x.x] PROTEIN CT_858
    7e-42  14%  3cskA  [x.x.x] PROBABLE DIPEPTIDYL-PEPTIDASE 3
    8e-40   9%  1e0tA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    1e-37   8%  3c3eA  [x.x.x] 2-PHOSPHO-L-LACTATE TRANSFERASE
    2e-29  11%  2c8eG  [x.x.x] MONO-ADP-RIBOSYLTRANSFERASE C3
    4e-29   7%  2cbuA  [x.x.x] BETA-GLUCOSIDASE A
    4e-25   9%  2cbuB  [x.x.x] BETA-GLUCOSIDASE A
    6e-25  16%  3cniA  [x.x.x] PUTATIVE ABC TYPE-2 TRANSPORTER
    2e-24  12%  3bjzB  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    5e-22  11%  3bjqH  [x.x.x] PHAGE-RELATED PROTEIN
    3e-21  13%  1at3A  [b.57.1] HERPES SIMPLEX VIRUS TYPE II PROTEASE
    4e-21  14%  3dpmA  [x.x.x] PROTEIN CT_858
    1e-20   9%  3e96A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    5e-18   8%  2cbvA  [c.1.8 (1oimA)] BETA-GLUCOSIDASE A
    1e-12  16%  3ecvD  [x.x.x] SUPEROXIDE DISMUTASE [CU-ZN]
    6e-04  16%  2e0iA  [x.x.x] 432AA LONG HYPOTHETICAL DEOXYRIBODIPYRIMIDINE
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
1bxsA           --FPVFNPATEEKLCEVEEGDKEDVDKAVKAARQIGSPWRTMDASERGRLLNKLADLIERDRLLLATMEA
2bhpA           --MVSLNPAPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKAAALMRRRKRELEATLV
3ek1B           --IKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT
2d4eC           --FPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMEC
2d4eA           --FPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMEC
3b4wA           --IEVRCPATGEYVXXXXXXXXXXXXXXXXXXXXXXGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLA
3ek1G           --IKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT
3ek1A           --IKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT
1a4zA           --FPTVNPSTGDVICHVAEGDKADVDRAVKAARQLGSPWRRMDASERGRLLNRLADLIERDRTYLAALET
1a4sA           --EPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEV
3ed6A           --RDIINPYNQEVIFTVSEGTKEDAERAILRRAFESGEWSQETAETRGKKVRAIADKIKEHREALARLET
1bi9D           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLLGSVWRRMDASERGRLLDKLADLVERDRATLATMES
1bi9A           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLLGSVWRRMDASERGRLLDKLADLVERDRATLATMES
2bjaA           --MVSLNPSPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKAAALMRRRKRELEATLV
3efvA           --ALSVNPATGQTLAAPWA-NAQEIEHALSLAASGFKKWKTS-VAQRAQTLRDIGQALRAHAEEAQCITR
3efvC           --ALSVNPATGQTLAAPWA-NAQEIEHALSLAASGFKKWKTS-VAQRAQTLRDIGQALRAHAEEAQCITR
1bi9C           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARSLGSVWRRMDASERGRLLDKLADLVERDRATLATMES
1ad3A           -----------------------SISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALA
1bi9B           --FPVCNPATGEQVCEVQEADKVDIDKAVQAARLLGSVWRRMDASERGRLLDKLADLVERDRATLATMES
1co3A           --FYATNAFTGEALLAFPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTIASELEARSDDIIARAH
1co3B           --FYATNAFTGEALPLFPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTIASELEARSDDIIARAH
1ddqC           ----------------------------------------------------------------------
3cyvA           ----------------------------------------------------------------------
3e08A           ------DLEPGIHTGRLTYGGYLRLDQLLSA---QQPLSEPAHHDEMLIQSQTSELWLKLLAHELRAAIV
3dorB           ----------------------------------------------------------------------
3c3dA           --TVVVNTAELWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGLGIEEGLKLGDRDRATHIIRSNI
3cgwA           --TVVVNTAELWVSGNLISPDLDTVLYLFSDQIDIENDTFGTYERKELGIEEGLKLGDRDRATHIIRSNI
3dorA           ----------------------------------------------------------------------
3cskA           ----------------------------------------------------------------------
1e0tA           QTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGV
3c3eA           --TVVVNTADLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDRKELGIEEGLKLGDRDRATHIIRSNI
2c8eG           ----------------------------------------------------------------------
2cbuA           --GNVKNGDTGDVACDHYNRWKEDIEIIEKKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLE---
2cbuB           --GNVKNGDTGDVACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEGTGRVN-QKGLDFYNRIIDTLL
3cniA           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3bjqH           --KRIDFGYEGDPYSIVSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHECAQIALDPAKKVK
1at3A           ----------------------------------------------------------------------
3dpmA           ----------------------------------------------------------------------
3e96A           ----------------------------------------------------------------------
2cbvA           --GNVKNGDTGDVACDHYNRWKEDIEIIEKKAYRFSISWPRILPEGTGRVNQKGLDFYNRIIDTLLE---
3ecvD           ----------------------------------------------------------------------
2e0iA           --------------------------------------------------LLELDDELRKKGSRL-NVFF


                         .         .         *         .         .         .         .:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
1bxsA           MNGGKLFSNAYMDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWK
2bhpA           YEVGKNWVEASADVAEAIDFIEYYARAALRYRAVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGM
3ek1B           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAQNGQRLTVIRQPVGVTAAITPWNFPAAMITRK
2d4eC           LDAGQVLRIVRAQVARAAENFAFYAEYAEHAMEDRTFPVDRDLYYTVRVPAGPVGIITPWNAPLMLSTWR
2d4eA           LDAGQVLRIVRAQVARAAENFAFYAEYAEHAMEDRTFPVDRDLYYTVRVPAGPVGIITPWNAPLMLSTWR
3b4wA           AETGQPPTIIEMHWMGSMGAMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGXXXXXXXXXXXXXXX
3ek1G           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQLTVIRQPVGVTAAITPWNFPAAMITRK
3ek1A           SEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQLTVIRQPVGVTAAITPWNFPAAMITRK
1a4zA           LDNGKPYIISYVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWK
1a4sA           INNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWK
3ed6A           LDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTSKIVKEPVGVVTQITPWNYPLLQASWK
1bi9D           LNGGKPFLQAFIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1bi9A           LNGGKPFLQAFIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
2bjaA           YEVGKNWVEASADVAEAIDFIEYYARAALRYRAVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGM
3efvA           --EGKPIKQARAEVTKSAALCDWYAEHG-PALNPEPTLVENQQAVIEYRPLG-VILAIPWNFPLWQVLRG
3efvC           --EGKPIKQARAEVTKSAALCDWYAEHG-PALNPEPTLVENQQAVIEYRPLG-VILAIPWNFPLWQVLRG
1bi9C           LNGGKPFLQAFIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1ad3A           SDLGKNEWTSYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQDLYIHSEPLGVVLVIGAWNYPFNLTIQP
1bi9B           LNGGKPFLQAFIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWK
1co3A           LETALPEVRLTGEIARTANQLRLFADVVNS-GSYHQAILDTPDIRRQQIALGPVAVFGASNFPLSAAGGD
1co3B           LETALPEVRLTGEIARTANQLRLFADVVNSGSYHQRAPLPKPDIRRQQIALGPVAVFGASNFPLSAAGGD
1ddqC           --DRYTIAQANTPLE-GDRIATDRVVARRRGEPVIVAPEEVEMDVSPKQVFSLNTNLIPFLEHDDANRAL
3cyvA           -------------------------------LKNDRYLRALLRQPVDVTPVW-MMRQAGRYLPEYKATRA
3e08A           HLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLT-----PSEYMGFRDVLGPSSGFQSLQYRYIE----
3dorB           -------------------------------------------LQVKYAPKTWKEQYLGWDLVQ------
3c3dA           IRDGASLTDSTVKLSSLFGIKILPSDDPVSTYIETAEGIHFQDFWIGKRGEPDVRGVDIRGVSEASISPK
3cgwA           IRDGASLTDSTVKLSSLFGIKILPSDDPVSTYIETAEGIHFQDFWIGKRGEPDVRGVDIRGVSEASISPK
3dorA           -----------------SLVCK----NALQDL--SFLEH---LLQVKYAPKTWKEQYLGWDLVQ------
3cskA           ----------------------------------------------------------------------
1e0tA           NLPGVSIALPALAEKDKQDLGVDFVAASFIRKRSDVIEIREHKAHGGENIHIISKIENQEGLNNFDEILE
3c3eA           IRDGASLTDSTVKLSSLFGIKILPSDDPVSTYIETAEGIHFQDFWIGKRGEPDVRGVDIRGVSEASISPK
2c8eG           ------------------------------------------TNIDQAKAWG-NAQYKKYGLSKSESASE
2cbuA           -KGITPFVTIYHW-DLPFALQLKGGWANREIADWFAEYSRVLFENFGDRVKNWITLNEPWVVAIVGHLYG
2cbuB           EKGITPFVTIYH-----WDLPFALQLKGGWANREIADWFAEYSRVLFENFGDRVKNWITLNEPWVVAIVG
3cniA           ----------------------------------------------------------------------
3bjzB           --------------------------------------------QLFQASIETKQQALEVLPPYIEQASL
3bjqH           LVGSARWTSPDKDVETAKEAIADSI-GEPNRLLSRKALSACKKALWEVEEIVVGTARVATGND-SFGDVW
1at3A           ------------------------------------------------VPIYVALYDSGDPGELALDPDT
3dpmA           ---------------------------------------------VKYAPKTWKEQYLGWDLVQ------
3e96A           -------------WHHYKETVDRIVDNGIDVIVLEEAKEEVRRTVEYVHGRALVVAGIGYATSTAIELGN
2cbvA           -KGITPFVTIYHW-----DLPFALQLKGGWANREIADWFAEYSRVLFENFGDRVKNWIPWVVAIVGHLYG
3ecvD           ----------------------------------------------------------------------
2e0iA           GEAEKVVSRFFNKVDAIYVNEDYTPFSISR---DEKIRKVCEENGIEFKAYEDYLLTPKSLFHHRNFTSF


                         +         .         .         .         .         *         .:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
1bxsA           IGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGPTAGAISSHMDVDKVAFTGSTEV
2bhpA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLVHPRIRFINFTGSLEV
3ek1B           AAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELSNDTVRKLSFTGSTEV
2d4eC           IAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGALVAHPLVPLLTLTGETET
2d4eA           IAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAAALVAHPLVPLLTLTGETET
3b4wA           XXXXXXXXCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSNPDIDMFTFTGSSAV
3ek1G           AAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELSNDTVRKLSFTGSTEV
3ek1A           AAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIAELTSNDTVRKLSFTGSTEV
1a4zA           LGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASEDVDKVAFTGSTEV
1a4sA           CAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPT
3ed6A           IAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMGHKEVDLVSFTGGIET
1bi9D           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAAAIASHIGIDKIAFTGSTEV
1bi9A           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIAHIGIDKIAFTGSTEV
2bjaA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLEHPRIRFINFTGSLEV
3efvA           AVPILLAGNSYLLKHAPNVTGCAQIARI-LAEAGTPAGVYGWVNANNEGVSQI-NDPRIAAVTVTGSVRA
3efvC           AVPILLAGNSYLLKHAPNVTGCAQIARI-LAEAGTPAGVYGWVNANNEGVSQI-NDPRIAAVTVTGSVRA
1bi9C           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAIASHIGIDKIAFTGSTEV
1ad3A           MVGAVAAGNAVILKPSEVSGHMADLLAT-LIPQYMDQNLY-LVVKGGVPETTELLKERFDHIMYTGSTAV
1bi9B           IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAAAIASHIGIDKIAFTGSTEV
1co3A           TASALAAGCPVIVKGHTAHPGTSQIIEQALKQEQLPQAIFTLLQGNQRALGQLVSHPEIKAVGFTGSVGG
1co3B           TASALAAGCPVIVKGHTAHPGTSQIIEQALKQEQLPQAIFTLLQGNQRALGQALSHPEIKAVGFTGSVGG
1ddqC           MGSNMQTQAVPLIRAQAPVVMIGLVRDSLAALYAEEDGEVVKVDGTRIAVRYEDGLVEHPLRRYARSNQG
3cyvA           QAGDFMSLCKVTLQPLRRYPLDAAILFSDILTPDAMGLGLYFEAGEGPRFTSVTCKADVDKLPIPDPEDE
3e08A           --FLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQDWTAAHVADDTLRPV
3dorB           --SSVSAQQKLRTQENPSTSFCQQVLADFIGGLDFHAGVTFFAIESAYLPVQKSSDGRVDIMTFSSEIRV
3c3dA           VLEAFEKEENILIGPSNPITSIGPIISLPGRELLKKKKVVA---VSPIIGNAPVSGPAGKLPACGIEVSS
3cgwA           VLEAFEKEENILIGPSNPITSIGPIISLPGRELLKKKKVVA---VSPIIGNAPVSGPAGKLPACGIEVSS
3dorA           --SSVSAQQKLRTQENPSTSFCQQVLADFIGGLNDFHAGVTFFAIESAYLPYTVQFYFVDIMTFSSEIRV
3cskA           ------------------------------SMLSVKTEYFPQL-----TDKEQKYAHFMSKASHAGSRVV
1e0tA           AGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMRPTDAEAGDVANAIDGTDAVMLSGEPLE
3c3eA           VLEAFEKEENILIGPSNPITSIGPIISL-PGRELLKKKKV--VAVSPIIGNAPVSGPAGKLPACGIEVSS
2c8eG           INGKLRQNKG-VIFPSNLIKQVELLDKS-FNKMKTPENIMLFR-----GDDPAYLGTEFQNTLLNSNGTI
2cbuA           VHAPGMRDIYVAFRAVHNLLRAHARAVKVFRETVKDGKIGIV--FNNGYFEPASEKDIRAVRFMHQFNNY
2cbuB           HLYGVHAPGMRDIYVAFRAVHNLLRAHARVFRETVKDGKIGIVFNNGYFASEKEEDIRAVRFMHQFNNYP
3cniA           -----------------------------------------------------------QKVAIVRED--
3bjzB           VVNALLNEGKILSCGNGGSAGDAQHFSSELLNRFERERPSYNEVFSKQIRALGQPGDVLLAISTSGNSAN
3bjqH           GPDVWLGYVSDNPDPSVEEPSFGYTYQIPLVEVPYWDNNA----------KSWIYGVSDDNTPALSGL-A
1at3A           VRAALPPENPLPINVDHRARCEVGRVLAVVNDPRGPFFVGLIACVQLERSVSLSTKPDRTLFAHVALCAI
3dpmA           --SSVSAQQKLRTQENPSTSFCQQVLADFIGGLNFHAGVFAIESAYLPYTVQKSSDGRVDIMTFSSEIRV
3e96A           AAKAAGADAVMIHMPIHPYVTAGGVYAYFREALDFPSLVYFKDPEISDRVLVDLAPQNLVGVKYAINDLP
2cbvA           VHAPGMRDIYVAFRAVHNLLRAHARAVKVFRETVKDGKIGIVFNNGYFEPASEKEDIRAVRFMHQFNNYP
3ecvD           ----------------------------------------------------------------------
2e0iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
1bxsA           GKLIKEAAGSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVR
2bhpA           GLKIYEAAGTWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLE
3ek1B           GRLLMAQCAPTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAE
2d4eC           GKIVMRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVG
2d4eA           GKIVMRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVG
3b4wA           GREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVA
3ek1G           GRLLMAQCAPTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAE
3ek1A           GRLLMAQCAPTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAE
1a4zA           GHLIQVAGKSNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVE
1a4sA           GKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLE
3ed6A           GKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQ
1bi9D           GKLIEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1bi9A           GKLIQEAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
2bjaA           GLKIYEAAQTWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKS-AASRLILTQGAYEPVLE
3efvA           GAAIGAQAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
3efvC           GAAIGAQAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTD
1bi9C           GKLIQEAAGSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1ad3A           GKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVE
1bi9B           GKLIQEAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVK
1co3A           GRALFNLAHPEPIPFYGELGAINPTFIFPSAMRAKADLAFVASMTMGCGQFCTKPGVVFALNTPETQAFI
1co3B           GRALFNLAHERPIPFYGELGAINPTFIFPSAMRAKADLAFVASMTMGCGQFCTKPGVVFALNTPETQAFI
1ddqC           TAFDQRRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHI
3cyvA           LGYVM----NAVRTIRHELKGEVPLIGFSGSPWTLATYMVEGGSSKAFTVIKKMMYADPQALHALLDKLA
3e08A           FERIYENTDRYWREYSLDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFD
3dorB           GDELLEVDGAPVQDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKVPSG----RTTLKIRRPFGTTR
3c3dA           GVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRA-------DTLTSTEKSKELAEIVVQAFLEH----
3cgwA           GVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRA-------DTLTSTEKSKELAEIVV----------
3dorA           GDELLEVDGAPVQDVLATLYGSNHKGTAAEESAAL----RTLFSRMASLGHKVPSGRTTLKIRRPFGTTR
3cskA           MRQVSHESFDLILAIHSKLNGKYP-----EDDITQKQQTGLYLEYVSQFLSNLGNFKSFGDTKFIPRCEV
1e0tA           AVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTN
3c3eA           GVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRATLTSTEKSKELAEIVVQAF---------------
2c8eG           NKTAFEKAAKFLNKDRLEYGYISTSLMNVFAGRPIITKFKVAKGSKA---------GYIDPISAFAGQLN
2cbuA           PLFLNPIYRGDYPELVLEFAREYLPENYKDDMSEIQEKIDFVGLNYYSGHLVKFDPDAKVSFVERDLPKT
2cbuB           LFLNPIYRGDYPELVLEFAREYLPENYKDDMSEIQEKIDFVGLNYYSGHLVKFDPDAKVSFVERDLPK--
3cniA           TGTIAELAEKALGNVDIVYAGSDPAIIVIPKGFSQSLESGEKARLEIVWYLRGTGLSEAVSTGTISSLIE
3bjzB           VIQAIQAAHDRELVVALTGRDGGGASLLLPEDVEIRVP--------SKITARIQEVHLLAIHCLCDLIDR
3bjqH           GYLIEDAG--------------------------------------------------------------
1at3A           GRRLGTIVDTSLDAAIAPFRHLDP----------------------------------------------
3dpmA           GDELLEVDGAPVQDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKVPSGRTTLKIRRPFGTTREVRV
3e96A           RFAKVVRSIPEEHQIAWICGTAEKWA---PFFWHAGAKGFTSGLVNLLPQKAVEMLEALRNNDN-DAVWR
2cbvA           LFLNPIYRGDYPELVLEFAREYLPENY-KDDMSEIQEKIDFVGLNYYSGHLVKFDPDAPAKVSFVERDLP
3ecvD           ----------------------------------------------------------------------
2e0iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
1bxsA           RSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVT
2bhpA           RVLKRAERLSVGPAEEN-PDLGPVVSAEQERKVLSYIEIGKNEGQLVLGGKRLEGE-GYFIAPTVFTEVP
3ek1B           KLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKELG--GLFFEPGILTGVT
2d4eC           KVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGRGEDLSRGNYLLPTVFV-GE
2d4eA           KVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKSRGNYLLPTVFV-GE
3b4wA           AVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRPEGLGFFIQPTVFADVD
3ek1G           KLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGK--ELGGLFFEPGILTGVT
3ek1A           KLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKELG--GLFFEPGILTGVT
1a4zA           RSVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCGGGAAADRGYFIQPTVFGDLQ
1a4sA           EVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPKLKNGYFMSPCVLDNCR
3ed6A           ALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLFFEPTVITNCD
1bi9D           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1bi9A           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
2bjaA           RVLKRAERLSVGPAEEN-PDLGPVVSAEQERKVLSYIEIGKNEGQLVLGGKRLEG-EGYFIAPTVFTEVP
3efvA           RFVAAAAAL-KGDPLVEENDLGPARF-DLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
3efvC           RFVAAAAAL-KGDPLVEENDLGPARF-DLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVT
1bi9C           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1ad3A           KLKKSLKDF-YGEDAKQSRDYGRII----NDRHFQRVKGLIDNQKVAHGGT--WDQSSRYIAPTILVDVD
1bi9B           RSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVT
1co3A           ET-----AQSLIRQQSPSTLLTPGIR---DSYQSQVVSRGSDDGIDVTFSQA----ESPCVASALFVTSS
1co3B           ET-----AQSLIRQQSPSTLLTPGIR-------DSYQSQVVSRGSDDGIDVTFSQAESPCVASALFVTSS
1ddqC           ERYEI-EARDTKLGPERITRDIPHLSEAALRDLDEEG--IVRIGAEVKPGDIL----VGRTSFKGEQEPS
3cyvA           LYLNAQIKAGAQAVMIFDTWGGVLTGRDYQQFSLYYMHKIVDGLLREN--------DGRRVPVTLFTKGG
3e08A           ----------------------------------------------------------------------
3dorB           EVRVKWRYVPEGVGDLATIAPSIRAPQLGYNIGSTDG---FLPVIGPVIWESEGLFRAYISSVTDGDGKS
3c3dA           ----------------------------------------------------------------------
3cgwA           ----------------------------------------------------------------------
3dorA           EVRVKWRYVPEGVGDLATIAPSIRAPQLGYNIGSTDGFLPVIGPVIWESEGLF---RAYISSVTDGDGKS
3cskA           KFFKQLLELAKINPSSSPLTLSPVDVNHEFTSHHLFSTINELIDIGIYHVELGFPSQGYTSAYYLGLPVT
1e0tA           EKTAHQLVLSKGVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTT-----------
3c3eA           ----------------------------------------------------------------------
2c8eG           MLLPRHSTYHIDDMRLS-SDGKQI----------------------------------------------
2cbuA           AMGWEIVPEGIYWILKKVKEEYN-----------------------------------------------
2cbuB           ----------------------------------------------------------------------
3cniA           SLKVQLASFLLNDPKKAQLLFDPLEIVQHTYLRGSLFKNHSPEAINVFYS--------------------
3bjzB           QL--------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
3dpmA           KWR-------------------------------------------------------------------
3e96A           IWEDIVPFEDLRGKYNQGNNVVVIKEAMEMLRQ-------------------------------------
2cbvA           KTAMGWEIVPEG----------------------------------------------------------
3ecvD           --------------------------------------------------------------------VQ
2e0iA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PGMPAFDEELFGPVAAIIRXXXXXXXXXXXXXSRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
1bxsA           DDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVS
2bhpA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGV
3ek1B           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
2d4eC           NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRH
2d4eA           NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRH
3b4wA           NKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINW-YAFD
3ek1G           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
3ek1A           SDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISN
1a4zA           DGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
1a4sA           DDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVAANLEAGTCYINTYSISP
3ed6A           TSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYF
1bi9D           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
1bi9A           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
2bjaA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGV
3efvA           PDT-AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEAA-RLECGGVFINGYSASD
3efvC           PDT-AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEAA-RLECGGVFINGYSASD
1bi9C           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCNAGEF
1ad3A           PQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMIAETSSGGVTANDVIITV
1bi9B           DDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWIN------
1co3A           ENWPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQVPRLEEIAGRLVFNEVEVGY
1co3B           EKHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQVSRLEEIAGRLVFNEVEVGY
1ddqC           PEER-LLRSIFGEKARDVK---------------------------------------------------
3cyvA           GQWLEAMAETGCDALGLDWRRVGNKVALQGNMDPSMLYAPPARIEEEVATILAGFGHGEGHVFNLGHGIH
3e08A           ----------------------------------------------------------------------
3dorB           HKVGFLRIPTYSWQDMEDFDPSGPPPWEEFAKIIQ-----VFSSNTEALIIDQTNNPGGSVLYL------
3c3dA           ----------------------------------------------------------------------
3cgwA           ----------------------------------------------------------------------
3dorA           HKVGFLRIPTYSWQDMEDF---------------------------------------------------
3cskA           PDMALLKEQLFAELAILPE--NTRINKVGENSFQIWVASENVKNQ------ITETYPSGQITLSN-AVTK
1e0tA           ----------------------------------------------------------------------
3c3eA           ----------------------------------------------------------------------
2c8eG           ----------------------------------------------------------------------
2cbuA           ----------------------------------------------------------------------
2cbuB           ----------------------------------------------------------------------
3cniA           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
3dpmA           ----------------------------------------------------------------------
3e96A           ----------------------------------------------------------------------
2cbvA           ----------------------------------------------------------------------
3ecvD           GIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLRHVGDLGNVTADKVSIED
2e0iA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK
1bxsA           AQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIK
2bhpA           GVQPFGGFKLSGTNAKTALDYLRLFLEMKAVAER
3ek1B           EVAPFGGVKQSGLGREGSKYGIEEYLETKYICSA
2d4eC           LPTPFGGVKGSGDRREGGTYALDFYTDLKTIALP
2d4eA           LPTPFGGVKGSGDRREGGTYALDFYTDLKTIALP
3b4wA           PGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLLP
3ek1G           EVAPFGGVKQSGLGREGSKYGIEEYLETKYICSA
3ek1A           EVAPFGGVKQSGLGREGSKYGIEEYLETKYICSA
1a4zA           AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVR
1a4sA           VEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE
3ed6A           AQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTN
1bi9D           -----------CYNALNGEFGLREYSEVKTVTVK
1bi9A           -----------CYGE----FGLREYSEVKTVTVK
2bjaA           GVQPFGGFKLSGTNAKTALDYLRLFLEMKAVAER
3efvA           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWK-
3efvC           ARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWK-
1bi9C           GLREYSEVKTVKIPQKNS----------------
1ad3A           PTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK
1bi9B           -----------CYGE----FGLREYSEVKTVTVK
1co3A           AMVHGGPYPASTHSASTSVEAIHRWLRPVAYQAL
1co3B           AMVHGGPYPASTHSASTSVEAIHRWLRPVAYQAL
1ddqC           ----------------------------------
3cyvA           QDVPPEHAGVHRLSEQYH----------------
3e08A           ----------------------------------
3dorB           ----------------------------------
3c3dA           ----------------------------------
3cgwA           ----------------------------------
3dorA           ----------------------------------
3cskA           VEFIFGDHSREMRLVASYLKEAQKFAANDTQKAM
1e0tA           ----------------------------------
3c3eA           ----------------------------------
2c8eG           ----------------------------------
2cbuA           ----------------------------------
2cbuB           ----------------------------------
3cniA           ----------------------------------
3bjzB           ----------------------------------
3bjqH           ----------------------------------
1at3A           ----------------------------------
3dpmA           ----------------------------------
3e96A           ----------------------------------
2cbvA           ----------------------------------
3ecvD           SVISLSG-DHCITGRTLVVHEK------------
2e0iA           ----------------------------------