[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57001.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c1wA.bssp"

## Summary of PDB Search
:548
    4e-19   9%  2c1wA  [x.x.x] ENDOU PROTEIN
:548

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c1wA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c1wA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSAQLPLTAWLPEAMA
2c1wA           -----------------------------------------------------GKDYRISL--QGKGYVS


                         .         .         .         +         .         .         .:280
query           APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVS
2c1wA           ASFPLFQFVDEEKLKSRKTFAT--------FISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETKVMK


                         .         *         .         .         .         .         +:350
query           QXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXX
2c1wA           MAHDYLVRKNQAKPTRNDFYNIWFQLYSRGSRPDSCGFEHVFVGERGQEMMGLHNWVQFYEKRKNIDYKG


                         .         .         .         .         *         .         .:420
query           XXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRxxxxxxxxxxxxxxxxxxxxxxxxxx
2c1wA           YVARQNKSRPDEDDQVLNLQFNWKEMVKPVGSSFIGVSPEFEFA--------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c1wA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c1wA           ----------------------------------------------------------