[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57113.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dfjA.bssp"
#ERROR : Can't open dsspfile "3e7aA.bssp"
#ERROR : Can't open dsspfile "3e7bA.bssp"
#ERROR : Can't open dsspfile "3c5wC.bssp"
#ERROR : Can't open dsspfile "2bcdA.bssp"
#ERROR : Can't open dsspfile "3ck2A.bssp"
#ERROR : Can't open dsspfile "3c8gD.bssp"
#ERROR : Can't open dsspfile "3e0jE.bssp"
#ERROR : Can't open dsspfile "1auiA.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"
#ERROR : Can't open dsspfile "3e0jA.bssp"
#ERROR : Can't open dsspfile "3dsdA.bssp"

## Summary of PDB Search
:228
    8e-13  25%  2dfjA  [x.x.x] DIADENOSINETETRAPHOSPHATASE
    5e-12  31%  3e7aA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA
    1e-10  27%  3e7bA  [x.x.x] SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA
    2e-10  24%  3c5wC  [x.x.x] PP2A C SUBUNIT
    1e-08  21%  2bcdA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA
    5e-08  12%  3ck2A  [x.x.x] CONSERVED UNCHARACTERIZED PROTEIN (PREDICTED
    5e-08   9%  3c8gD  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    1e-07   9%  3e0jE  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    4e-06  20%  1auiA  [d.159.1] SERINE/THREONINE PHOSPHATASE 2B
    6e-06   9%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    7e-06  12%  3e0jA  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    2e-05  18%  3dsdA  [x.x.x] DNA DOUBLE-STRAND BREAK REPAIR PROTEIN MRE11
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
2dfjA           --------------YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLYVKSLGSVRL
3e7aA           --------ELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLIKYPNFFL
3e7bA           --------ELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLF-LGDYVDRGKQSLETICLIKYPNFFL
3c5wC           --------EVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLF-MGDYVDRGYYSVETVTLLVALKITI
2bcdA           --------------KICGDIHGQYYDLLRLFEYGGF-PPESNYLFLGDYVDRGKQSLETICLIKYPNFFL
3ck2A           --------------IIVSDSHGDSLIVEEVRDRYVGKV--DAVFHNGDSELRPDSPLWEGIRVFYAYPER
3c8gD           ------------EDDVLEQLDAQDNLAHSILLQGIRQFLPSLFVDNDEEIVEYAVPLLAQSGPVALRLIY
3e0jE           -------ESLLGTQLLVDVVTGQLGDEGEQCSAAHVS----RVILAGNLLSHLTKKTQAASVEAVKMLDE
1auiA           ----------------CGDIHGQFFDLMKLFEVGGSPA-NTRYLFLGDYVDRGYFSIECVLYLYPKTLFL
3e0jC           -------ESLLGTQLLVDVVTGQLGDEGEQCSAAHVS----RVILAGNLLSHLTKKTQAASVEAVKMLDV
3e0jA           -------ESLLGTQLLVDVVTGQLGDEGEQCSAAHV----SRVILAGNLLSHLKTQAASVEAVKMLDEIL
3dsdA           --------------AHLADIHLGYEQFHKPQREEEFAEAFKNALEIGDLFHSSRPSPGTLKKAIALLVFA


                         .         .         *         .         .         .         .:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
2dfjA           VLGNHDLHLLAVFAGISRNKPKDRLTPLLEA-----PDADELLNWLRRQPLLQID--EEKKLVMAHAGIT
3e7aA           LRGNHECASI----------NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDE---KIFCCHGGLS
3e7bA           LRGNHECASINRIYGFYDECKRRY--NIKLW--------KTFTDCFNCLPIAAIVDE---KIFCCHGGLS
3c5wC           LRGNHESRQIT-QVYGFYDECLRKYGNANVW--------KYFTDLFDYLPLTALVDGQIFCLHGGLSPSI
2bcdA           LRGNHECASINTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDP
3ck2A           LVTELGST---KIIQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEG---KILFLNPGSIS
3c8gD           ALGDKWLYADITHFSQYYLNEQDETPGFADDITWD-----------------------------------
3e0jE           ILLQSVPVDVMPGEFDP---TNYTLPQQPLHPCMFPLATAYSTLQLVTNPY--QATIDGVRFLGTSGQNV
1auiA           LRGNHECRHLTEYF-------------TFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS
3e0jC           MPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEI
3e0jA           LQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIF
3dsdA           IEGNSDRTQRGPSVLNLLEDFGLVYVIGMRK---------------------------------------


                         +         .         .         .         .         *         .:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAx
2dfjA           PQWDL-----------------------------------------------------------------
3e7aA           PDLQSMEQIRRIMR--------------------------------------------------------
3e7bA           PDLQSMEQIRRIMRGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDG----------------
3c5wC           DTLDHIRALDRLQE--------------------------------------------------------
2bcdA           DKDVL---------GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL-------
3ck2A           QPRGT-----------------------------------------------------------------
3c8gD           ----------------------------------------------------------------------
3e0jE           SDIFRYSSMEDHLEILEWTLRHISPTAPDTKTDPFIFPECPHVYFCGNTPSFGS--KIIRGPEDQTVLL-
1auiA           PEINTLDDIRKLDR--------------------------------------------------------
3e0jC           LEWTLRVRHISPTAPDTKTDPFIFPECPHV-------------YFCGNTPS--FGSKIIRGPEDQTVLL-
3e0jA           RYSSMEDHLEILEWTLRVRHISPTAPDTYKTDPFIFP-ECPHVYFCGNTPSFG--SKIIRGPEDQTVL--
3dsdA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
2dfjA           ------------------
3e7aA           ------------------
3e7bA           ------------------
3c5wC           ------------------
2bcdA           ------------------
3ck2A           ------------------
3c8gD           ------------------
3e0jE           ------------------
1auiA           ------------------
3e0jC           ------------------
3e0jA           ------------------
3dsdA           ------------------