[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57445.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA.bssp"

## Summary of PDB Search
:325
    3e-06  23%  3dhwA  [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN[MASQUE
:325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxEVGKDYVRTARAKGLSEFKVLFKHILKNALIPILTGAVVxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           -------EIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATI------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           ---------------------------------------------