[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57493.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dkkA.bssp"
#ERROR : Can't open dsspfile "1bb3A.bssp"
#ERROR : Can't open dsspfile "132lA.bssp"
#ERROR : Can't open dsspfile "1at5A.bssp"
#ERROR : Can't open dsspfile "2cwiA.bssp"
#ERROR : Can't open dsspfile "1a2yC.bssp"
#ERROR : Can't open dsspfile "1b5zA.bssp"
#ERROR : Can't open dsspfile "1b7mA.bssp"
#ERROR : Can't open dsspfile "1ckcA.bssp"
#ERROR : Can't open dsspfile "1b5yA.bssp"
#ERROR : Can't open dsspfile "1b7qA.bssp"
#ERROR : Can't open dsspfile "1c7pA.bssp"
#ERROR : Can't open dsspfile "1cj8A.bssp"
#ERROR : Can't open dsspfile "1cj6A.bssp"
#ERROR : Can't open dsspfile "1b9oA.bssp"
#ERROR : Can't open dsspfile "1alcA.bssp"
#ERROR : Can't open dsspfile "1b5vA.bssp"
#ERROR : Can't open dsspfile "1di4A.bssp"
#ERROR : Can't open dsspfile "1b7nA.bssp"
#ERROR : Can't open dsspfile "135lA.bssp"
#ERROR : Can't open dsspfile "1b7lA.bssp"
#ERROR : Can't open dsspfile "1di3A.bssp"
#ERROR : Can't open dsspfile "1b5xA.bssp"
#ERROR : Can't open dsspfile "1d0lA.bssp"
#ERROR : Can't open dsspfile "1b7oA.bssp"
#ERROR : Can't open dsspfile "1a4vA.bssp"
#ERROR : Can't open dsspfile "1b5uA.bssp"
#ERROR : Can't open dsspfile "1ckdA.bssp"
#ERROR : Can't open dsspfile "2bqhA.bssp"
#ERROR : Can't open dsspfile "1b7rA.bssp"
#ERROR : Can't open dsspfile "1ckhA.bssp"
#ERROR : Can't open dsspfile "134lA.bssp"
#ERROR : Can't open dsspfile "1c45A.bssp"
#ERROR : Can't open dsspfile "2bqfA.bssp"
#ERROR : Can't open dsspfile "2bqkA.bssp"
#ERROR : Can't open dsspfile "153lA.bssp"
#ERROR : Can't open dsspfile "1b5wA.bssp"
#ERROR : Can't open dsspfile "1d6qA.bssp"
#ERROR : Can't open dsspfile "1c43A.bssp"
#ERROR : Can't open dsspfile "2bqmA.bssp"
#ERROR : Can't open dsspfile "1cj7A.bssp"
#ERROR : Can't open dsspfile "2bqcA.bssp"
#ERROR : Can't open dsspfile "1b7pA.bssp"
#ERROR : Can't open dsspfile "3csrA.bssp"
#ERROR : Can't open dsspfile "1b7sA.bssp"
#ERROR : Can't open dsspfile "1ckgA.bssp"
#ERROR : Can't open dsspfile "1di5A.bssp"
#ERROR : Can't open dsspfile "2bqlA.bssp"
#ERROR : Can't open dsspfile "1cj9A.bssp"
#ERROR : Can't open dsspfile "1c46A.bssp"
#ERROR : Can't open dsspfile "133lA.bssp"

## Summary of PDB Search
:218
    1e-13  18%  1dkkA  [d.2.1] LYSOZYME
    1e-11  14%  1bb3A  [d.2.1] LYSOZYME
    4e-11  14%  132lA  [x.x.x] HEN EGG WHITE LYSOZYME
    6e-11  16%  1at5A  [x.x.x] LYSOZYME
    2e-10  14%  2cwiA  [x.x.x] LYSOZYME C, MILK ISOZYME
    4e-10  18%  1a2yC  [d.2.1] LYSOZYME
    6e-10  15%  1b5zA  [d.2.1] LYSOZYME
    7e-10  14%  1b7mA  [d.2.1] PROTEIN (LYSOZYME)
    9e-10  15%  1ckcA  [d.2.1] PROTEIN (LYSOZYME)
    2e-09  13%  1b5yA  [d.2.1] PROTEIN (LYSOZYME)
    3e-09  15%  1b7qA  [d.2.1] PROTEIN (LYSOZYME)
    4e-09  13%  1c7pA  [d.2.1] LYSOZYME
    5e-09  14%  1cj8A  [d.2.1] PROTEIN (LYSOZYME)
    5e-09  15%  1cj6A  [d.2.1] PROTEIN (LYSOZYME)
    7e-09  21%  1b9oA  [d.2.1] PROTEIN (ALPHA-LACTALBUMIN)
    9e-09  17%  1alcA  [x.x.x] ALPHA-LACTALBUMIN
    1e-08  12%  1b5vA  [d.2.1] PROTEIN (LYSOZYME)
    1e-08  16%  1di4A  [d.2.1] LYSOZYME C
    2e-08  13%  1b7nA  [d.2.1] PROTEIN (LYSOZYME)
    2e-08  17%  135lA  [d.2.1 (1dzbX)] TURKEY EGG WHITE LYSOZYME
    2e-08  14%  1b7lA  [d.2.1] PROTEIN (LYSOZYME)
    4e-08  15%  1di3A  [d.2.1] LYSOZYME C
    4e-08  13%  1b5xA  [d.2.1] PROTEIN (LYSOZYME)
    5e-08  11%  1d0lA  [d.2.1] 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
    7e-08  15%  1b7oA  [d.2.1] PROTEIN (LYSOZYME)
    1e-07  13%  1a4vA  [x.x.x] ALPHA-LACTALBUMIN
    1e-07  15%  1b5uA  [d.2.1] PROTEIN (LYSOZYME)
    1e-07  16%  1ckdA  [d.2.1] PROTEIN (LYSOZYME)
    2e-07  20%  2bqhA  [x.x.x] LYSOZYME
    3e-07  12%  1b7rA  [d.2.1] PROTEIN (LYSOZYME)
    3e-07  15%  1ckhA  [d.2.1] PROTEIN (LYSOZYME)
    3e-07  17%  134lA  [x.x.x] HUMAN LYSOZYME
    3e-07  15%  1c45A  [d.2.1] PROTEIN (LYSOZYME)
    5e-07  20%  2bqfA  [x.x.x] LYSOZYME
    6e-07  19%  2bqkA  [x.x.x] LYSOZYME
    6e-07  11%  153lA  [x.x.x] GOOSE LYSOZYME
    8e-07  13%  1b5wA  [d.2.1] PROTEIN (LYSOZYME)
    1e-06  13%  1d6qA  [d.2.1] LYSOZYME
    1e-06  14%  1c43A  [d.2.1] PROTEIN (HUMAN LYSOZYME)
    2e-06  20%  2bqmA  [x.x.x] LYSOZYME
    3e-06  15%  1cj7A  [d.2.1] PROTEIN (LYSOZYME)
    3e-06  20%  2bqcA  [x.x.x] LYSOZYME
    4e-06  16%  1b7pA  [d.2.1] PROTEIN (LYSOZYME)
    1e-05   9%  3csrA  [x.x.x] MORPHOGENESIS PROTEIN 1
    3e-05  16%  1b7sA  [x.x.x] LYSOZYME
    9e-05  19%  1ckgA  [d.2.1] PROTEIN (LYSOZYME)
    1e-04  17%  1di5A  [d.2.1] LYSOZYME C
    2e-04  20%  2bqlA  [x.x.x] LYSOZYME
    3e-04  13%  1cj9A  [d.2.1] PROTEIN (LYSOZYME)
    5e-04  14%  1c46A  [d.2.1] LYSOZYME
    8e-04  14%  133lA  [x.x.x] HUMAN LYSOZYME
:218

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIFEKQPEWYDYAKESEKKWGTPTPILM
1dkkA           ------------------------------------------------LAAAMKRHGLDNYRGYSLGNWV
1bb3A           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
132lA           -------------------------------------------VFGR-CELAAAMRHGLDNYRGYSLGNW
1at5A           -------------------------------------------VFGRCELAAMKRHGLDNYRGYSLGNWV
2cwiA           --------------------------------------------------RKLKSMGMDGFHGYSLANWV
1a2yC           --------------------------------------------------AAMKRHGLANYRGYSLGNWV
1b5zA           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1b7mA           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
1ckcA           -------------------------------------------VFERCELRTLKRLGMDGYRGISLANWM
1b5yA           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
1b7qA           -------------------------------------------VFERCELARLKRLGMDGYRGISLALWM
1c7pA           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1cj8A           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1cj6A           --------------------------------------------------RALKRLGMDGYRGISLANWM
1b9oA           -------------------------------------------QFTK-CELSQLLKDIDGYGGIALPELI
1alcA           -----------------------------------------------KCELSQNLYDIDGYGRIALPELI
1b5vA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
1di4A           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1b7nA           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
135lA           -------------------------------------------VYGRCELAAMKRLGLDNYRGYSLGNWV
1b7lA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
1di3A           -------------------------------------------VFERCELRTLKRLGMDGYRGISLANWM
1b5xA           ----------------------------------------------------LKRLGMDGYRGISLANWM
1d0lA           --------------------------------------------------TLSFNYPRRAEYFSGELETF
1b7oA           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
1a4vA           -------------------------------------------QFTK-CELSQLLKDIDGYGGIALPELI
1b5uA           -------------------------------------------VFERCEARTLKRLGMDGYRGIALANWM
1ckdA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
2bqhA           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1b7rA           ----------------------------------------------------LKRLGMDGYRGISLANWM
1ckhA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
134lA           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
1c45A           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
2bqfA           -------------------------------------------VFERCELARLKRLGMDGYRGISLANWM
2bqkA           -------------------------------------------VFERCEARTLKRLGMDGYRGISLANWM
153lA           ------------------------------------------------DRYKTIIKKVGEKLCVEPAVIA
1b5wA           ----------------------------------------------------LKRLGMDGYRGISLANWM
1d6qA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
1c43A           ----------------------------------------------------LKRLGMDGYRGISLANWM
2bqmA           -------------------------------------------VFERCELRTLKRLGMDGYRGISLANWM
1cj7A           --------------------------------------------------RVLKRLGMDGYRGISLANWM
2bqcA           ----------------------------------------------------LKRLGMDGYRGVSLANWM
1b7pA           --------------------------------------------------RTLKRLGMDGYRGISLANWM
3csrA           -------------------------------------------------VNAQYILNYLSSNGWTKCGML
1b7sA           ----------------------------------------------KVFERCELARGMDGYRGISLANWM
1ckgA           ----------------------------------------------------LKRLGMDGYRGISLANWM
1di5A           ----------------------------------------------------LKRLGMDGYRGISLANWM
2bqlA           ----------------------------------------------------LKRLGMDGYRGISLANWM
1cj9A           ----------------------------------------------------LKRLGMDGYRGISLANWM
1c46A           ----------------------------------------------------LKRLGMDGYRGISLANWM
133lA           ----------------------------------------------------LKRLGMDGYRGISLANWM


                         .         .         *         .         .         .         .:140
query           AFIHRESSFRGDARPPRRWFLGFIPLPRSSSAYGYGQIQDPAWEDYLGANGGWFKSRADMEDVLDFIGWY
1dkkA           CAAKFESNFNSQATNRN---------TDGSTDYGVLQINSRWWCND-GKTPGSRNLCNIPCSALLSSDIT
1bb3A           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND-GKTPGAVNACHLSCSALLQDNIA
132lA           VCAAFESNFNTQAT---------NRNTDGSTDYGILQINSRWWCND-GRTPGSRNLCNIPCSALLSSDIT
1at5A           CAAKFESNFNTQATNR---------NTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITA
2cwiA           CMAEYESNFNTQAFNGRNS--------NGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLIDDDIAC
1a2yC           CAAKFESNFNTQAT---------NRNTDGSTDYGILQINSRWWCND-GRTPGSRNLCNIPCSALLSSDIT
1b5zA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGAVNACHLSCAALLQDNIADAVAC
1b7mA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND----GKTPGAVNACHLSCSALLQD
1ckcA           CLAKWESGYNTRAANYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
1b5yA           CLAKWEAGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
1b7qA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVLSCSALLQDNIADAVAC
1c7pA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND-GKTPGAVNACHLSCSALLQDNIA
1cj8A           CLAKWESGYNARATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
1cj6A           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVNACSALLQDNIADAVAC
1b9oA           CTMFHTSGYDTQAIVE----------NDESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLD-----
1alcA           CTMFHTSGYDTQAIVE----------NDESTEYGLFQISNALWCKSSQSPQSRNICDITCDKFLD-----
1b5vA           CLAKWESGYNTRATNYN--------AGDRATDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
1di4A           CLAKWESGYNTRATNYNDR----------STDYGIFQINSRYWCNDGKTPGAVLSCSALLQDNIADAVAC
1b7nA           CLAKWLSGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
135lA           CAAKFESNFNTHATN---------RNTDGSTDYGILQINSRWWCND-GRTPGSKNLCNIPCSALLSSDIT
1b7lA           CLLKWESGYNTRATNYNA--------GDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIAD
1di3A           CLAKWESGYNTRATNY--------NAGDGSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
1b5xA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCND-GKTPGAVNACHLACSALLQDNIA
1d0lA           LLMARDEQDDPLN-----------LKGSFAGAMGYGQFMPSSYKQYVDFSGDGHINLWDPVDAIGSVANY
1b7oA           CLAKWESQYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
1a4vA           CTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDIS---------------------
1b5uA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVLSCSALLQDNIADAVAC
1ckdA           CLAKWESGYNTRAVNYNAG--------DRSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
2bqhA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND------------------------
1b7rA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFGINSRYWCN-DGKTPGAVNACHLSCSALLQDNIA
1ckhA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKVPGAVNACSALLQDNIADAVAC
134lA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
1c45A           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
2bqfA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND------------------------
2bqkA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAV-----------------
153lA           GIISRESHAGKVLKNGW---------GDRGNGFGLMQVDKRSHKPQ-----GTWNGEVHITQGTTILINF
1b5wA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINARYWCND-GKTPGAVNACHLSCSALLQDNIA
1d6qA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCND----GKTPGAVNACHLSCSALLQD
1c43A           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGAVNACHLSCSALLQDNIADAVAC
2bqmA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCND------------------------
1cj7A           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAVNACSALLQDNIADAVAC
2bqcA           CLAKWESGYNTRATNYN--------AGDRSTDYGIFQINSRYWCND------------------------
1b7pA           CLAKWESGYNTRATNYNAG--------DRSTDYGIFQINSRYWCNDGKTPGAVLSCSALLQDNIADAVAC
3csrA           GNMQSESTINPGL-------WQNLDEGNTSLGFGLVQWTPASNYINWANSQGMDSELKRIIWEVNNNAQW
1b7sA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGASNACHLSCSALLQDNIAD
1ckgA           CLAKWESGYNTRATNYNAG--------DRSVDYGIFQINSRYWCNDGKTPGAV-----------------
1di5A           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQD----
2bqlA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCND------------------------
1cj9A           CLAKWESGYNVRATNY--------NAGDRSTDYGIFQINSRYWCND----GKTPGAVNACHLSCSALL-Q
1c46A           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALL-----Q
133lA           CLAKWESGYNTRATNY--------NAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALL-----Q


                         +         .         .         .         .         *         .:210
query           NHISARRLGISKRNPEHLYLAYHEGHRGYQRGAWRRKPHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dkkA           ATVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIR----------------------------------
1bb3A           DAVACLKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQ----------------------------------
132lA           ASVNCAKIV----SDGNGMNAWV-AWRNRCGTDVQAW---------------------------------
1at5A           SVNCAKKIVSNGMNAWVAWRNRCKGTQAWIRGC-------------------------------------
2cwiA           AKRVVKDPNGMS-----AWVAWVKHCKGKDLSKYLASCNL------------------------------
1a2yC           ASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL------------------------------
1b5zA           ----AKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1b7mA           NIADAMKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQ----------------------------------
1ckcA           AVACAKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQ----------------------------------
1b5yA           AVACAKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1b7qA           ----AKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1c7pA           DAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1cj8A           AVACAKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQG---------------------------------
1cj6A           ----AKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1b9oA           ----------------------------------------------------------------------
1alcA           ----------------------------------------------------------------------
1b5vA           AVACAKRVRDPQGIRAWVAWRNRCQNRDVRQ--YVQGCGV------------------------------
1di4A           AKRVVRDPQGIRAWV--AWRNRCQNRDQYVQGC-------------------------------------
1b7nA           AVACAKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
135lA           ASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRG---------------------------------
1b7lA           AVACAKRVVRDPQGIRAWVAWRCQNRD-------------------------------------------
1di3A           AKRVVRDPQ---GIRAWVAWRNRCQNRDVRQ--YVQG---------------------------------
1b5xA           DAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1d0lA           FKVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAA-----------------------------------
1b7oA           ---AKRVVRDPQGIRAWVAWRNRCQNRDVRQ--YVQ----------------------------------
1a4vA           ----------------------------------------------------------------------
1b5uA           ----AKRV-VRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1ckdA           AKRVVRDPQ--GIRAWVAWRNRCQNRRQYVQGC-------------------------------------
2bqhA           ----------------------------------------------------------------------
1b7rA           DAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1ckhA           AKRVVRDPQ-GIRAWVAWR-NRCQNRD-------------------------------------------
134lA           AKRVVRDPQ--GIRAWVAWRNECQNRRQYVQGC-------------------------------------
1c45A           KRVVRDPQGI---RAWVAWRNRCQNRD---VRQYVQGCGV------------------------------
2bqfA           ----------------------------------------------------------------------
2bqkA           ----------------------------------------------------------------------
153lA           IKTIQKKFPTKDQQLKGGISAYNAGAGNVRSYARMDIG--------------------------------
1b5wA           DAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV------------------------------
1d6qA           NIADAVACAVVREPQGIRAWAWRNRCQNRDVRQYVQGCGV------------------------------
1c43A           KRVVRDPQGI---RAWVAWRNRCQNRD---VRQYVQGCGV------------------------------
2bqmA           ----------------------------------------------------------------------
1cj7A           AKRVVRDPQ---GIRAWVAWRNRCQNRDVRQ---------------------------------------
2bqcA           ----------------------------------------------------------------------
1b7pA           KRVVRDPQGI---RAWVAWRNRCQNRDQYVQGC-------------------------------------
3csrA           INLRDMTFKEYIKSTKTPRELAMIFLASYERPANP-----------------------------------
1b7sA           AVACAKRV-VRDPQGIRAWVARCQNRD---VRQYVQGCGV------------------------------
1ckgA           ----------------------------------------------------------------------
1di5A           ----------------------------------------------------------------------
2bqlA           ----------------------------------------------------------------------
1cj9A           DNIADAVACAKRVVRDPQGIRAWVAWRNRCQN--------------------------------------
1c46A           DNIADAVACAKRVVRDPQGIRAWVAWRNRCQN--------------------------------------
133lA           DNIADAVACAKRVVRDPQGIRAWVAWRNHCQN--------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxx
1dkkA           --------
1bb3A           --------
132lA           --------
1at5A           --------
2cwiA           --------
1a2yC           --------
1b5zA           --------
1b7mA           --------
1ckcA           --------
1b5yA           --------
1b7qA           --------
1c7pA           --------
1cj8A           --------
1cj6A           --------
1b9oA           --------
1alcA           --------
1b5vA           --------
1di4A           --------
1b7nA           --------
135lA           --------
1b7lA           --------
1di3A           --------
1b5xA           --------
1d0lA           --------
1b7oA           --------
1a4vA           --------
1b5uA           --------
1ckdA           --------
2bqhA           --------
1b7rA           --------
1ckhA           --------
134lA           --------
1c45A           --------
2bqfA           --------
2bqkA           --------
153lA           --------
1b5wA           --------
1d6qA           --------
1c43A           --------
2bqmA           --------
1cj7A           --------
2bqcA           --------
1b7pA           --------
3csrA           --------
1b7sA           --------
1ckgA           --------
1di5A           --------
2bqlA           --------
1cj9A           --------
1c46A           --------
133lA           --------