[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57498.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cvbA.bssp"
#ERROR : Can't open dsspfile "3c71A.bssp"
#ERROR : Can't open dsspfile "2c0dB.bssp"
#ERROR : Can't open dsspfile "3c73B.bssp"
#ERROR : Can't open dsspfile "3c73A.bssp"
#ERROR : Can't open dsspfile "3cynC.bssp"
#ERROR : Can't open dsspfile "1e2yG.bssp"
#ERROR : Can't open dsspfile "2cv4A.bssp"
#ERROR : Can't open dsspfile "2b7jB.bssp"
#ERROR : Can't open dsspfile "2bmxB.bssp"
#ERROR : Can't open dsspfile "2e2mC.bssp"
#ERROR : Can't open dsspfile "1e2yC.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "3drnA.bssp"
#ERROR : Can't open dsspfile "1e2yD.bssp"
#ERROR : Can't open dsspfile "2cv4E.bssp"
#ERROR : Can't open dsspfile "1e2yE.bssp"
#ERROR : Can't open dsspfile "2e2gB.bssp"
#ERROR : Can't open dsspfile "2cv4D.bssp"
#ERROR : Can't open dsspfile "3drnB.bssp"
#ERROR : Can't open dsspfile "3cynB.bssp"
#ERROR : Can't open dsspfile "1e2yF.bssp"
#ERROR : Can't open dsspfile "2e2mH.bssp"
#ERROR : Can't open dsspfile "1e2yB.bssp"
#ERROR : Can't open dsspfile "3cmiA.bssp"
#ERROR : Can't open dsspfile "2bmxA.bssp"
#ERROR : Can't open dsspfile "2e2mE.bssp"
#ERROR : Can't open dsspfile "2dj0A.bssp"
#ERROR : Can't open dsspfile "1e2yH.bssp"
#ERROR : Can't open dsspfile "2b7jA.bssp"
#ERROR : Can't open dsspfile "3cynA.bssp"
#ERROR : Can't open dsspfile "3dwvA.bssp"
#ERROR : Can't open dsspfile "2cx3A.bssp"
#ERROR : Can't open dsspfile "2b7kA.bssp"
#ERROR : Can't open dsspfile "2b5xA.bssp"
#ERROR : Can't open dsspfile "2e2gA.bssp"
#ERROR : Can't open dsspfile "2e2mD.bssp"
#ERROR : Can't open dsspfile "2e2mA.bssp"
#ERROR : Can't open dsspfile "2cx3B.bssp"
#ERROR : Can't open dsspfile "2c0dA.bssp"
#ERROR : Can't open dsspfile "2b5eA.bssp"
#ERROR : Can't open dsspfile "1eejA.bssp"
#ERROR : Can't open dsspfile "2b7kB.bssp"
#ERROR : Can't open dsspfile "2a4vA.bssp"
#ERROR : Can't open dsspfile "2e2gC.bssp"
#ERROR : Can't open dsspfile "3boaA.bssp"
#ERROR : Can't open dsspfile "2ec4A.bssp"
#ERROR : Can't open dsspfile "2b1kA.bssp"
#ERROR : Can't open dsspfile "3e0uA.bssp"
#ERROR : Can't open dsspfile "2aytA.bssp"
#ERROR : Can't open dsspfile "3c7mA.bssp"
#ERROR : Can't open dsspfile "2dlxA.bssp"
#ERROR : Can't open dsspfile "1a8yA.bssp"
#ERROR : Can't open dsspfile "2dj1A.bssp"
#ERROR : Can't open dsspfile "2dj2A.bssp"
#ERROR : Can't open dsspfile "2c1yB.bssp"
#ERROR : Can't open dsspfile "2dmmA.bssp"
#ERROR : Can't open dsspfile "2axoA.bssp"
#ERROR : Can't open dsspfile "2albA.bssp"
#ERROR : Can't open dsspfile "3dvwA.bssp"
#ERROR : Can't open dsspfile "2dmlA.bssp"
#ERROR : Can't open dsspfile "1a8lA.bssp"
#ERROR : Can't open dsspfile "3bj5A.bssp"
#ERROR : Can't open dsspfile "2c0eA.bssp"
#ERROR : Can't open dsspfile "3d22A.bssp"
#ERROR : Can't open dsspfile "2crlA.bssp"
#ERROR : Can't open dsspfile "1egoA.bssp"
#ERROR : Can't open dsspfile "3d21A.bssp"
#ERROR : Can't open dsspfile "3c1sA.bssp"
#ERROR : Can't open dsspfile "2c1yA.bssp"
#ERROR : Can't open dsspfile "2dizA.bssp"
#ERROR : Can't open dsspfile "2c0eB.bssp"
#ERROR : Can't open dsspfile "3c1rA.bssp"
#ERROR : Can't open dsspfile "2b1lA.bssp"

## Summary of PDB Search
:193
    1e-31  43%  2cvbA  [x.x.x] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    3e-23  23%  3c71A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-22  18%  2c0dB  [x.x.x] THIOREDOXIN PEROXIDASE 2
    3e-22  23%  3c73B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    3e-22  23%  3c73A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    3e-21  17%  3cynC  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    5e-21  18%  1e2yG  [c.47.1] TRYPAREDOXIN PEROXIDASE
    5e-21  11%  2cv4A  [x.x.x] PEROXIREDOXIN
    8e-21  10%  2b7jB  [x.x.x] SCO1 PROTEIN
    9e-21  13%  2bmxB  [x.x.x] ALKYL HYDROPEROXIDASE C
    3e-20  10%  2e2mC  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-19  17%  1e2yC  [c.47.1] TRYPAREDOXIN PEROXIDASE
    2e-19  18%  1e2yA  [c.47.1] TRYPAREDOXIN PEROXIDASE
    3e-19  18%  3drnA  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    5e-19  18%  1e2yD  [c.47.1] TRYPAREDOXIN PEROXIDASE
    6e-19  11%  2cv4E  [x.x.x] PEROXIREDOXIN
    7e-19  17%  1e2yE  [c.47.1] TRYPAREDOXIN PEROXIDASE
    4e-18  11%  2e2gB  [x.x.x] PROBABLE PEROXIREDOXIN
    7e-18  11%  2cv4D  [x.x.x] PEROXIREDOXIN
    8e-18  17%  3drnB  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    3e-17  18%  3cynB  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    5e-17  17%  1e2yF  [c.47.1] TRYPAREDOXIN PEROXIDASE
    8e-17  10%  2e2mH  [x.x.x] PROBABLE PEROXIREDOXIN
    8e-17  17%  1e2yB  [c.47.1] TRYPAREDOXIN PEROXIDASE
    8e-17  15%  3cmiA  [x.x.x] PEROXIREDOXIN HYR1
    8e-17  13%  2bmxA  [x.x.x] ALKYL HYDROPEROXIDASE C
    1e-16  11%  2e2mE  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-16  11%  2dj0A  [x.x.x] THIOREDOXIN-RELATED TRANSMEMBRANE PROTEIN 2
    2e-16  22%  1e2yH  [c.47.1] TRYPAREDOXIN PEROXIDASE
    3e-16  12%  2b7jA  [x.x.x] SCO1 PROTEIN
    6e-16  17%  3cynA  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    8e-16  17%  3dwvA  [x.x.x] GLUTATHIONE PEROXIDASE-LIKE PROTEIN
    3e-15  21%  2cx3A  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    4e-15  12%  2b7kA  [x.x.x] SCO1 PROTEIN
    4e-15  18%  2b5xA  [x.x.x] YKUV PROTEIN
    5e-15  14%  2e2gA  [x.x.x] PROBABLE PEROXIREDOXIN
    9e-15  11%  2e2mD  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-14  11%  2e2mA  [x.x.x] PROBABLE PEROXIREDOXIN
    2e-14  23%  2cx3B  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    6e-14  16%  2c0dA  [x.x.x] THIOREDOXIN PEROXIDASE 2
    2e-13  10%  2b5eA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    6e-13   7%  1eejA  [d.17.3 - c.47.1] THIOL:DISULFIDE INTERCHANGE PROTEIN
    9e-13  17%  2b7kB  [x.x.x] SCO1 PROTEIN
    9e-13  15%  2a4vA  [x.x.x] PEROXIREDOXIN DOT5
    4e-12  11%  2e2gC  [x.x.x] PROBABLE PEROXIREDOXIN
    6e-12   9%  3boaA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    1e-11  11%  2ec4A  [x.x.x] FAS-ASSOCIATED FACTOR 1
    5e-11  21%  2b1kA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    7e-11  18%  3e0uA  [x.x.x] GLUTATHIONE PEROXIDASE
    2e-10   4%  2aytA  [x.x.x] GLUTAREDOXIN-LIKE PROTEIN
    2e-09  14%  3c7mA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA-LIKE
    8e-09   8%  2dlxA  [x.x.x] UBX DOMAIN-CONTAINING PROTEIN 7
    8e-09  11%  1a8yA  [x.x.x] CALSEQUESTRIN
    7e-08  11%  2dj1A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A4
    6e-07  19%  2dj2A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A4
    1e-06   7%  2c1yB  [x.x.x] WINDBEUTEL PROTEIN
    2e-06  11%  2dmmA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A3
    3e-06  11%  2axoA  [x.x.x] HYPOTHETICAL PROTEIN ATU2684
    2e-05  12%  2albA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A3
    2e-05  14%  3dvwA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    6e-05  18%  2dmlA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A6
    1e-04   9%  1a8lA  [x.x.x] PROTEIN DISULFIDE OXIDOREDUCTASE
    2e-04  12%  3bj5A  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    2e-04  12%  2c0eA  [x.x.x] WINDBEUTEL PROTEIN
    2e-04  17%  3d22A  [x.x.x] THIOREDOXIN H-TYPE
    3e-04  17%  2crlA  [x.x.x] COPPER CHAPERONE FOR SUPEROXIDE DISMUTASE
    3e-04  19%  1egoA  [x.x.x] GLUTAREDOXIN
    4e-04  19%  3d21A  [x.x.x] THIOREDOXIN H-TYPE
    4e-04  17%  3c1sA  [x.x.x] GLUTAREDOXIN-1
    5e-04  15%  2c1yA  [x.x.x] WINDBEUTEL PROTEIN
    6e-04  16%  2dizA  [x.x.x] THIOREDOXIN DOMAIN-CONTAINING PROTEIN 5
    6e-04  12%  2c0eB  [x.x.x] WINDBEUTEL PROTEIN
    7e-04  16%  3c1rA  [x.x.x] GLUTAREDOXIN-1
    7e-04  20%  2b1lA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
2cvbA           ----QYPELPLESPLIDAEL-PDPRGGRYRLSQFHEP--LLAVVFCNHCPYVKGSIGELVALAERYRGKV
3c71A           ------------SDAPNFVLED-TNGKRIELSDLKG-KGVFLNFWGTWCPHCKKEFPYMANQYKHFKSQG
2c0dB           ----------VTKKAYNFTANKNNEIINVDLSSFIGQKYCCLLYPLNYTFVCPTEIIEFNKHIKDFENKN
3c73B           ------------SDAPNFVLED-TNGKRIELSDLKG-KGVFLNFWGTWCEHCKKEFPYMANQYKHFKSQG
3c73A           ------------SDAPNFVLED-TNGKRIELSDLKG-KGVFLNFWGTWCEHCKKEFPYMANQYKHFKSQG
3cynC           ---TENLFQSMINSFYAFEV-KDAKGRTVSLEKYKG-KVSLVVNVASDCQLTDRNYLGLKELHKEFGPSH
1e2yG           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
2cv4A           -------IPLIGERFPEEVTTD-HGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
2b7jB           --------------GGPFHL-EDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKY
2bmxB           -------LIGGDLSKVDAKQPG-DYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRD
2e2mC           -------IPLIGERFPEMEVTTDHVIKLPDHYVSQG-KWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
1e2yC           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
1e2yA           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
3drnA           --------VKVGDKAPLFEG-IADNGEKISLSDYIGKHNIVLYYPKDDTPGSTREASAFRDNWDLLKDYD
1e2yD           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
2cv4E           -------IPLIGERFPEEVTTD-HGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
1e2yE           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
2e2gB           -------IPLIGERFPEMEVTTDHVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLG
2cv4D           -------IPLIGERFPEEVTTD-HGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
3drnB           --------VKVGDKAPLFEG-IADNGEKISLSDYIGKHNIVLYYPKDDTPGSTREASAFRDNWDLLKDYD
3cynB           ------YFQSMINSFYAFEV-KDAKGRTVSLEKYKG-KVSLVVNVASDCQLTDRNYLGLKELHKEFGPSH
1e2yF           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
2e2mH           -------IPLIGERFPEMEVTTDGVIKLPDHYVSQG-KWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
1e2yB           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
3cmiA           ------------SEFYKLAP-VDKKGQPFPFDQLKGKV-VLIVNVASKCGFTPQYK-ELEALYKRYKDEG
2bmxA           --------IGGDLSKVDAKQPG-DYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRD
2e2mE           -------IPLIGERFPEMEV--TTVIKLPDHYVSQGKWFV-LFSHPADFTPVTTEFVSFARRYEDFQRLG
2dj0A           -----------GSSGSSGYIKY-FNDKTIDEELERDKRVTWIVFFANWSNDCQSFAPIYADLSLKYNCTG
1e2yH           ----------LNHPAPEFDDLPNGTFKKVSLSSYKG-KYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEIN
2b7jA           -----------PSLGGPFHL-EDMYGNEFTEKNLLGKFSIIYFGCPDICPDELDKLGLWLNTLSSKYGIT
3cynA           ----ENLFQSMINSFYAFEV-KDAKGRTVSLEKYKG-KVSLVVNVASDCQLTDRNYLGLKELHKEFGPSH
3dwvA           --------MSAASSIFDFEVLD-ADHKPYNLVQHKGSP-LLIYNVASKCGYTKGGYETATTLYNKYKSQG
2cx3A           -------LVELGEKAPDFTL-PNQDFEPVNLYEVLKRGRPAVLFPAAFSPVCTKELCTFRDKAQLEK-AN
2b7kA           -----------PSLGGPFHL-EDMYGNEFTEKNLLGKFSIIYFGFPDICPDELDKLGLWLNTLSSKYGIT
2b5xA           --------MKLRQPMPELTGKAWLNGEVTREQLIGE-KPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQL
2e2gA           -------IPLIGERFPEMEVTTDHVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLG
2e2mD           ----------IGERFPEMEVTTDGVIKLPDHYVSQG-KWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
2e2mA           -------IPLIGERFPEMEVTTHGVIKLPDHYVSQG-KWFVLFSHPADFTPVTTEFVSFARRYEDFQRLG
2cx3B           -------LVELGEKAPDFTL-PNQDFEPVNLYEVLKRGRPAVLFPAAFSPVCTKELCTFRDKAQLEKAN-
2c0dA           ----------VTKKAYNFTANKNNEIINVDLSSFIGQKYCCLLYPLNYTFVCPTEIIEFNKHIKDFENKN
2b5eA           -------MQQEAVAPEDSAVVK-LATDSFNEYIQSH-DLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN
1eejA           YDVSGTAPVNVTNKMLLKQL-NALEKEMIVYKAPQE-KHVITVFTDITCGYCHKLHEQMADYNALGITVR
2b7kB           --------------GGPFHL-EDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKY
2a4vA           ----DVNELEIGDPIPDLSL-LNEDNDSISLKKITENNRVVVFYPRASTPGSTRQASGFRDNYQELKEYA
2e2gC           -------IPLIGERFPEMEVTTDHVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLG
3boaA           -----------AVAPEDSAVVK-LATDSFNEYIQSH-DLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN
2ec4A           LQFTAEFSSRYGDCHPVFFILEAAFQEAFYVKARDR-KLLAIYLHHDESVLTNVFCSQMLCAESIVSYLS
2b1kA           ----------IGKPVPKFRLSLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIR--
3e0uA           ---------------YEFQV-NAADGKPYDLSQHKGHP-LLIYNVASRCGYTKGGYETATTLYNKYKGQG
2aytA           --------------LLNLDVRM-QLKELAQKEFKEP-VSIKLFSQAIGCESCQTAEELLKETVEVIGEAV
3c7mA           -------------------FTEGTDYMVLEKPIPNA-DKTLIKVFSYACPFCYKYDKAVTGPVSEKVKDI
2dlxA           -GIDKKLTTLADLFRPPIDLMHKGSETAKECGQMQN-KWLMINIQNVQDFACQCLNRDVWSNEAVKNIIR
1a8yA           -----------GLDFPEYDGVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQV
2dj1A           --------------KEENGVWV-LNDGNFDNFVADK-DTVLLEFYAPWCGHCKQFAPEYEKIASTLKDND
2dj2A           ------------------------TKDNFDDVVNNA-DIILVEFYAPWCGHCKKLAPEYEKAAKELSKRS
2c1yB           --------------------CVDLDELSFEKTVERF-PYSVVKFDIAYPKGEKHEAFTAFSKSAHK--AT
2dmmA           -----------SEPIPESNDKVVVAENFDEIVNNEN-KDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDP
2axoA           ----------------------------------EAVKGVVELFTSQGCASCPPADEALRKIQKGDVVGL
2albA           --------------SDVLELTD-DNFESRISDTGSA-GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIV
3dvwA           --------------AGLVEGQNYTVLANPIPQQQAGKV-EVLEFFGYFCPHCAHLEPVLSKHAKSF-KDD
2dmlA           ---------------------------------------------------VIELTPS-NFNREVIQSDG
1a8lA           --------------LISDADKK-VIKEEFFSKMVNP-VKLIVFVRKDHCQYCDQLKQLVQELSELTDKLS
3bj5A           ----------------------------------GEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKI
2c0eA           ---------------------VDLDELSFEKTVERF-PYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKD
3d22A           LCLAEPHIELAGGNVHLITTKE-RWDQKLSEASRDG-KIVLANFSARWCGPSRQIAPYYIELSENYPSL-
2crlA           ---------------------------------------EFAVQMCQSC--VDAVRKSLQGVA------G
1egoA           ----------------------------------------TVIFGRSGCPYCVRAKDLAEKLSNERDDFQ
3d21A           -------------NVHLITTKE-RWDQKLSEASRDG-KIVLANFSARWCGPCKQIAPYYIELSENYPSL-
3c1sA           ----------------------------------------IFVASKTYCPYCHAALNTLFEKLKVPRSK-
2c1yA           ---------------------------------------SVVKFDIAYPKGEKHEAFTAFSKSAHKATKD
2dizA           -----------GSSGSSGTVLA------LTENNFDDTGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGL
2c0eB           ------------------------DELSFEKTVERF-PYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKD
3c1rA           ----------------------------------------IFVASKTYCPYCHAALNTLFEKLKVPRSKV
2b1lA           ----------------------------------------LLNVWATWCPTCRAEHQYLNQLSAQGIRVV


                         .         .         *         .         .         .         .:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
2cvbA           -AFVGINANDYEKYPED-APEKAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRV
3c71A           VEIVAVNV-------GESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVV-----
2c0dB           VELLGISVDSVYSHLAWKNMPIEKGG-IGNVEFTLVSDINKDISKNYNSFALRGLFIIDKNGCVRHQTVN
3c73B           VEIVAVNV-------GESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVV-----
3c73A           VEIVAVNV-------GESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVV-----
3cynC           FSVLAFPCNQFGESEPRPSKEVESFARKNGVTFPIFHKIKILGSEGKEPRWNFWKYLVNPEGQVVKFWRP
1e2yG           TEVISCSCDS----EYSHLQWTSVDRKKGGLPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
2cv4A           VDLIGLSVDSVFSH--IKWKEWIERHIGVRIPFPIIADPQGTVARRLGTHTVRGVFIVDARGVIRTLYYP
2b7jB           GITLQPLFITCDPARDSPAKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVKPGQDYLVDHSIF
2bmxB           AQILGVSIDSEFAH-----FQWRAQHNDLKTLPFPLSDIKRELSQAADGVADRVTFIVDPNNEIQFVSAT
2e2mC           VDLIGLSVDSVFSHIKWKEWIERH--IGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGV
1e2yC           TEVISCSCDSEYSHLQW---TSVDRKKGGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
1e2yA           TEVISCSCDS----EYSHLQWTSVDRKKGGGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
3drnA           VVVIGVSSDDI--------NSHKRFKEKYKLPFILVSDPDKKIRELYGAKGFILTFVIDKKGIIRHIYNS
1e2yD           TEVISCSC----DSEYSHLQWTSVDRKKGGGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
2cv4E           VDLIGLSVDSVFS--HIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESVFIVDARGVIRTLYYP
1e2yE           TEVISCSCDSEYSHLQWT---SVDRKKGGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
2e2gB           VDLIGLSVDSVFSHIKWKEWIERH--IGVRIPFPIIADPQGTVARRLGLLHATHVFIVDARGVIRTMLYY
2cv4D           VDLIGLSVD--SVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAEGVFIVDARGVIRTLYYP
3drnB           VVVIGVSSDDI--------NSHKRFKEKYKLPFILVSDPDKKIRELYGILPARITFVIDKKGIIRHIYNS
3cynB           FSVLAFPCNQFGEEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGKEPRWNFWKYLVNPEGQVVKFWRP
1e2yF           TEVISCSCDSEYSHLQWTSVDRKKGG---LGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
2e2mH           VDLIGLSVDS--VFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLAESATHTVRGVFIVDARGVI
1e2yB           TEVISCSCDS----EYSHLQWTSVDRKKGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKL
3cmiA           FTIIGFPCNQFGGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSS
2bmxA           AQILGVSIDSEFAHFQWRAQHN-----DLKTLPFPLSDIKRELSQAADGVADRVTFIVDPNNEIQFVSAT
2e2mE           VDLIGLSVDS--VFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVFIVDARGVIRTMLYY
2dj0A           LNFGKVDVG--RYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAWTFSEENVIREFNLN
1e2yH           TEVISCSCDSEYSHLQWTSVDRKKGGL---GPAIPLADKTKAIARAYGVLAYRGVFIIDPNGKLRQIIIN
2b7jA           LQPLFITCDPARDSPAVLKEYL-SDFHPSILGLTGTFDEVKNACKKYRVYVDHSIFFYLMDPEGQFVDAL
3cynA           FSVLAFPCNQFGESEPRPSKEVESFARKNGVTFPIFHKIKILGSEGEEPRWNFWKYLVNPEGQVVKFWRP
3dwvA           FTVLAFPSNQFGGQEPGNEEEIKEFVCTKFKAFPIMAKINVNGENAHPLYEYMKPGILATKAIKWNFTSF
2cx3A           AEVLAISV--------DSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLVFIVKPDGTVAYKWVT
2b7kA           LQPLFITCDPARDSPAV-LKEYLSDFHPSILGLTGTFDEVKNACKKYRVLVDHSIFFYLMDPEGQFVDAL
2b5xA           NVVAV---HMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHF---
2e2gA           VDLIGLSVDSVFSHIK--WKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRIVDARGVIRTM---
2e2mD           VDLIGLSVD--SVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRGVFIVDA---RGVI
2e2mA           VDLIGLSVDSVFS--HIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVFIVDARGVIRTMLYY
2cx3B           AEVLAISV--------DSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHERAVFIVKPDGTVAYKWV-
2c0dA           VELLGISVDSVY-SHLAWKNMPIEKGGIGNVEFTLVSDINKDISKNDNSFALRGLFIIDKNGCVRHQTVN
2b5eA           ITLAQID--------CTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQP---
1eejA           YLAFPRQGLDSAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQP--
2b7kB           GITLQPLFITC-DPARDSPAVLKEYLSDFHPSILGTFDEVKNACKKYRVYFSTPFYLMDPEGQFVDA---
2a4vA           A-VFGLSA--------DSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGASGSIRSHFIFVDGKLKFKR--
2e2gC           VDLIGLSVDSVFSHIKWKEWIERH--IGVRIPFPIIADPQGTVARRLGLLSATHVFIVDARGVIRTMLYY
3boaA           IT--------LAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQP---
2ec4A           QNFITWAWDLTK---------DSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRS---SNEV
2b1kA           --VVGMNY-------KDDRQKAISWLKELGNPYALLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYR---
3e0uA           FTVLAFPCNQFAGFACPIMAKIDVNGSKAHPLYEFMKATIPGLFGTKAIKWNFTSFLIDRHGVPVER---
2aytA           GQDKIKLDIY----SPFTHKEETEKYGVDRVPTIVIEGDKDYGIRYIGLPAGLEFTTLINGI--------
3c7mA           VAFTPFHLETKGEYGKQASEVFAVLINKDKAAGISLFDANSQFKKAYYAAYHDKKERWSDGKDPAAFIKT
2dlxA           -------------------------EHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV---
1a8yA           L------------------------EDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDG--
2dj1A           PPIAVAKIDA---------------------------TSASMLASKFDVSGYPTIKILKKGQAVDYDGSR
2dj2A           PPI---------------------------PLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPFDYNGPR
2c1yB           KDLLIATVGVKDYGELENKALGDRKVDDKNFPSIFLFKGNADEYVQLPS---------------------
2dmmA           --------NIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKK-----------------------
2axoA           SYHVDYWNYLGWTDSLASKENTERQYGYRALGRNGVYTPQAILNGRDHVKGADVRGIYDRLDAFKREGQG
2albA           PLAKVDC---------TANTNTCNKYGVSGYPTLKIFRDGEEAGAYD-----------------------
3dvwA           MYLRTE---HVVWQKEMLTL--------------------------------------------------
2dmlA           LWLVEFYAPWCGHCQRLTPKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPED---
1a8lA           YEIVDFDT--------PEGKELAKRYRIDRAPATTITQDGKDFGVRYFGLPAGHEFAAFLED--------
3bj5A           L-FAFIDSDHTDN------QRILEFFGLKKEECP-----------------AVRLITLEEEMTKYKP--E
2c0eA           LLIATVGVKDY-GELENKALGDRYKVDDKNFPSIFLFKGNADEYV-------------------------
3d22A           ------------------------------MFLVIDVDELSDFSASWEIKATP-TFFFLRDGQQVDK---
2crlA           VQDVEVHLQMVLVHTTLPSQEVQALLEGTGR-QAVLKGMGSGQLQNSGPS--------------------
1egoA           YQYVDIRAE------GITKEDLQQKAGKPVETVPQIFVDQQHI---------------------------
3d21A           ------------------------------MFLVIDVDELSDFSASWEIKATP-TFFFLRDGQQVDK---
3c1sA           --VLVLQLNDMKEGADIQAA-LYEINGQRT--VPNIYINGKHIGG-------------------------
2c1yA           LLIATVGVKDYGE--LENKALGDRKVDDKNFPSIFLFKGNADEYV-------------------------
2dizA           AGVKIAEVDCTAE---------------------------RNICSKYSVRGYP-TLLLFRGGKKVSE---
2c0eB           LLIATVGVKDYGE--LENKALGDRKVDDKNFPSIFLFKGNADEYV-------------------------
3c1rA           LVLQL----NDMKEGADIQAALYEINGQRT--VPNIYINGKHIGG-------------------------
2b1lA           GMNY-----------KDDRQKAISWLKELGNPYALLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYR---


                         +         .         .         .         .         *         .:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNEPDYxx
2cvbA           NDN-PKDPSKVQSHDLEAAIEALLRGEEPPLKEAPAIGCTIKWRPGNEPE---
3c71A           ----KVVTGTMTESMIHDYMNLIKPGET-------------------------
2c0dB           DLPIGRNV-----QEVLRTIDSIIH------VDTSGEVCPINWKKG-------
3c73B           ----KVVTGTMTESMIHDYMNLIKPGE--------------------------
3c73A           ----KVVTGTMTESMIHDYMNLIKPG---------------------------
3cynC           EEPIEV-----IRPDIAALVRQVIIKK--------------------------
1e2yG           RQIIIN---DPIGRNVEEVIRLVEALQF---VEEHGEVCPANWK---------
2cv4A           E----------LGRLVDEILRIVKALK---LGDSLKRAVPADWPNNEII----
2b7jB           FYLMDPEGRNYDEKTGVDKIVEHVKS---YVPAEQRAKQKEAWY---------
2bmxB           AGSVGRNV-----DEVLRVLDALQ----------SDELCASNWR---------
2e2mC           IRTMLYYPME-LGRLVDEILRIVKALKL---GDSLKRAVPADWPNNEII----
1e2yC           RQIIIN---DPIGRNVEEVIRLVEALQ--------------------------
1e2yA           RQIIIND---PIGRNVEEVIRLVEALQ--------------------------
3drnA           QMNPANHV-----NEALKALKQIKEEEI-------------------------
1e2yD           RQIIIN---DPIGRNVEEVIRLVEALQ--------------------------
2cv4E           E----------LGRLVDEILRIVKALKL---GDSLKRAVPADWPNNEII----
1e2yE           RQIIIND---PIGRNVEEVIRLVEALQ--------------------------
2e2gB           PMELGRL-----------VDEILRIVKALKLGDSLKRAVPADWPNNEII----
2cv4D           E----------LGRLVDEILRIV---KALKLGDSLKRAVPADWPNNEII----
3drnB           QMNPANHV-----NEALKALKQIKEEE--------------------------
3cynB           EEPIEV-----IRPDIAALVRQVIIKK--------------------------
1e2yF           RQIIIN---DPIGRNVEEVIRLVEALQFV------------------------
2e2mH           RTMLYYPMEL-----GRLVDEILRIVKALKLGDSLKRAVPADWPNNEII----
1e2yB           RQIIINDP---IGRNVEEVIRLVEALQ--------------------------
3cmiA           LTKPSSLS-----ETIEELLKEV------------------------------
2bmxA           AGSVGRNV-----DEVLRVLDA-------------------------------
2e2mE           PME--------LGRLVDEILRI---VKALKLGDSLKRAVPADWPNNEII----
2dj0A           ELSGPSS----------------------------------------------
1e2yH           DP---------IGRNVEEVIRLVEALQ--------------------------
2b7jA           GRNYDEKTGV---DKIVEHVKSYVPAE--------------------------
3cynA           EEPIEV-----IRPDIAALVRQVIIKKK-------------------------
3dwvA           LIDRDGVSPGASVKDIEEKLIPLL-----------------------------
2cx3A           DNPLNEPDY----DEVVREANKIA-GELV------------------------
2b7kA           -----GRNYDEKTDKIVEHVKSYV-----------------------------
2b5xA           -----------------------------------------------------
2e2gA           -----------------------------------------------------
2e2mD           RTMLYYPMELGRLVDEILRI-----VKALKLGDSLKRAVPADWPNNEIIGE--
2e2mA           PMELGRLVDEILRIV-----------KALKLGDSLKRAVPADWPNNEII----
2cx3B           ------TDNPLNEPDYDEVVREAIAGELV------------------------
2c0dA           DLPIGRNV-----QEVLRTIDSIIH------VDTSGEVC--------------
2b5eA           -----------------------------------------------------
1eejA           -----------------------------------------------------
2b7kB           -----------------------------------------------------
2a4vA           ---VKISPEVSVNDAKKEVLEVAEKFK--------------------------
2e2gC           PMELGRLVDEILRIV-----------KALKLGDSLKRAVPADWPNNEII----
3boaA           -----------------------------------------------------
2ec4A           LNVIQG---NTTVDELMMRLMAAME----------------------------
2b1kA           -----------------------------------------------------
3e0uA           ------FSPGASVEDIEKKLLPLLGGA--------------------------
2aytA           -----------------------------------------------------
3c7mA           GLDAAGMSQADFEAALK------------------------------------
2dlxA           -----------------------------------------------------
1a8yA           -----------------------------------------------------
2dj1A           T----------------------------------------------------
2dj2A           E----------------------------------------------------
2c1yB           -----------------------------------------------------
2dmmA           -----------------------------------------------------
2axoA           LNVPVGDEVEIDIGAGNGKADVVV-----------------------------
2albA           -----------------------------------------------------
3dvwA           -----------------------------------------------------
2dmlA           ------YQGGRTGEAIVDAALSALRSGPSS-----------------------
1a8lA           -----------------------------------------------------
3bj5A           SEELTAERIEFCHRFLEGKIKPHLMSQELPEDW--------------------
2c0eA           -----------------------------------------------------
3d22A           -----------------------------------------------------
2crlA           -----------------------------------------------------
1egoA           -----------------------------------------------------
3d21A           -----------------------------------------------------
3c1sA           -----------------------------------------------------
2c1yA           -----------------------------------------------------
2dizA           -----------------------------------------------------
2c0eB           -----------------------------------------------------
3c1rA           -----------------------------------------------------
2b1lA           -----------------------------------------------------