[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cv4A.bssp"
#ERROR : Can't open dsspfile "2cv4E.bssp"
#ERROR : Can't open dsspfile "2cv4D.bssp"
#ERROR : Can't open dsspfile "2e2mC.bssp"
#ERROR : Can't open dsspfile "2e2mH.bssp"
#ERROR : Can't open dsspfile "2c0dB.bssp"
#ERROR : Can't open dsspfile "2e2mE.bssp"
#ERROR : Can't open dsspfile "2e2gB.bssp"
#ERROR : Can't open dsspfile "2e2mA.bssp"
#ERROR : Can't open dsspfile "2e2mD.bssp"
#ERROR : Can't open dsspfile "2e2gA.bssp"
#ERROR : Can't open dsspfile "2bmxB.bssp"
#ERROR : Can't open dsspfile "2e2gC.bssp"
#ERROR : Can't open dsspfile "2bmxA.bssp"
#ERROR : Can't open dsspfile "3drnA.bssp"
#ERROR : Can't open dsspfile "3drnB.bssp"
#ERROR : Can't open dsspfile "2c0dA.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "2cvbA.bssp"
#ERROR : Can't open dsspfile "2b7jA.bssp"
#ERROR : Can't open dsspfile "1e2yG.bssp"
#ERROR : Can't open dsspfile "2b7jB.bssp"
#ERROR : Can't open dsspfile "3c9dA.bssp"
#ERROR : Can't open dsspfile "1e2yC.bssp"
#ERROR : Can't open dsspfile "1e2yE.bssp"
#ERROR : Can't open dsspfile "1e2yB.bssp"
#ERROR : Can't open dsspfile "1e2yD.bssp"
#ERROR : Can't open dsspfile "2cx3B.bssp"
#ERROR : Can't open dsspfile "2cx3A.bssp"
#ERROR : Can't open dsspfile "2b7kA.bssp"
#ERROR : Can't open dsspfile "1e2yH.bssp"
#ERROR : Can't open dsspfile "3dwvA.bssp"
#ERROR : Can't open dsspfile "2b5xA.bssp"
#ERROR : Can't open dsspfile "3cynB.bssp"
#ERROR : Can't open dsspfile "3cynC.bssp"
#ERROR : Can't open dsspfile "3c71A.bssp"
#ERROR : Can't open dsspfile "3c73B.bssp"
#ERROR : Can't open dsspfile "2b7kB.bssp"
#ERROR : Can't open dsspfile "1e2yF.bssp"
#ERROR : Can't open dsspfile "3cynA.bssp"
#ERROR : Can't open dsspfile "3c73A.bssp"
#ERROR : Can't open dsspfile "2b8aA.bssp"
#ERROR : Can't open dsspfile "2b1kA.bssp"
#ERROR : Can't open dsspfile "2a4vA.bssp"
#ERROR : Can't open dsspfile "3cmiA.bssp"
#ERROR : Can't open dsspfile "2dj0A.bssp"
#ERROR : Can't open dsspfile "2dlxA.bssp"
#ERROR : Can't open dsspfile "3boaA.bssp"
#ERROR : Can't open dsspfile "2b5eA.bssp"
#ERROR : Can't open dsspfile "1a8yA.bssp"
#ERROR : Can't open dsspfile "1eejA.bssp"
#ERROR : Can't open dsspfile "3c7mA.bssp"
#ERROR : Can't open dsspfile "2ec4A.bssp"

## Summary of PDB Search
:212
    2e-37  33%  2cv4A  [x.x.x] PEROXIREDOXIN
    2e-35  32%  2cv4E  [x.x.x] PEROXIREDOXIN
    3e-35  33%  2cv4D  [x.x.x] PEROXIREDOXIN
    4e-35  28%  2e2mC  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-33  28%  2e2mH  [x.x.x] PROBABLE PEROXIREDOXIN
    3e-31  28%  2c0dB  [x.x.x] THIOREDOXIN PEROXIDASE 2
    8e-31  27%  2e2mE  [x.x.x] PROBABLE PEROXIREDOXIN
    7e-30  32%  2e2gB  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-27  25%  2e2mA  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-27  32%  2e2mD  [x.x.x] PROBABLE PEROXIREDOXIN
    5e-27  32%  2e2gA  [x.x.x] PROBABLE PEROXIREDOXIN
    3e-26  28%  2bmxB  [x.x.x] ALKYL HYDROPEROXIDASE C
    3e-26  31%  2e2gC  [x.x.x] PROBABLE PEROXIREDOXIN
    5e-26  28%  2bmxA  [x.x.x] ALKYL HYDROPEROXIDASE C
    5e-26  29%  3drnA  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    6e-25  29%  3drnB  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    5e-24  27%  2c0dA  [x.x.x] THIOREDOXIN PEROXIDASE 2
    1e-22  26%  1e2yA  [c.47.1] TRYPAREDOXIN PEROXIDASE
    2e-22  12%  2cvbA  [x.x.x] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    2e-22  10%  2b7jA  [x.x.x] SCO1 PROTEIN
    2e-22  27%  1e2yG  [c.47.1] TRYPAREDOXIN PEROXIDASE
    4e-22  11%  2b7jB  [x.x.x] SCO1 PROTEIN
    4e-22  12%  3c9dA  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 75
    1e-21  27%  1e2yC  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-21  27%  1e2yE  [c.47.1] TRYPAREDOXIN PEROXIDASE
    7e-21  26%  1e2yB  [c.47.1] TRYPAREDOXIN PEROXIDASE
    8e-21  27%  1e2yD  [c.47.1] TRYPAREDOXIN PEROXIDASE
    8e-21  29%  2cx3B  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    1e-20  28%  2cx3A  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    2e-20  10%  2b7kA  [x.x.x] SCO1 PROTEIN
    4e-20  27%  1e2yH  [c.47.1] TRYPAREDOXIN PEROXIDASE
    5e-20  11%  3dwvA  [x.x.x] GLUTATHIONE PEROXIDASE-LIKE PROTEIN
    8e-20  12%  2b5xA  [x.x.x] YKUV PROTEIN
    2e-19  13%  3cynB  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    4e-19  15%  3cynC  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    7e-19  26%  3c71A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    4e-18  25%  3c73B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-18  11%  2b7kB  [x.x.x] SCO1 PROTEIN
    1e-17  27%  1e2yF  [c.47.1] TRYPAREDOXIN PEROXIDASE
    5e-17  15%  3cynA  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    3e-16  25%  3c73A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    5e-16   8%  2b8aA  [x.x.x] HEPATOMA-DERIVED GROWTH FACTOR
    3e-15  21%  2b1kA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    6e-15  22%  2a4vA  [x.x.x] PEROXIREDOXIN DOT5
    1e-12  10%  3cmiA  [x.x.x] PEROXIREDOXIN HYR1
    4e-10   9%  2dj0A  [x.x.x] THIOREDOXIN-RELATED TRANSMEMBRANE PROTEIN 2
    2e-07   5%  2dlxA  [x.x.x] UBX DOMAIN-CONTAINING PROTEIN 7
    4e-07  10%  3boaA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    4e-07  10%  2b5eA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    3e-06  13%  1a8yA  [x.x.x] CALSEQUESTRIN
    4e-06   7%  1eejA  [d.17.3 - c.47.1] THIOL:DISULFIDE INTERCHANGE PROTEIN
    1e-04  12%  3c7mA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA-LIKE
    8e-04   8%  2ec4A  [x.x.x] FAS-ASSOCIATED FACTOR 1
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
2cv4A           --PLIGERFPEEVTTDHGVKLPDHYVSQGKWFVLFSHPADFTP-VTTEFVSFARRYEDFQRLGVDLIGLS
2cv4E           ----IGERFPEEVTTDHGVKLPDHYVSQGKWFVLFSHPADFTPVTT-EFVSFARRYEDFQRLGVDLIGLS
2cv4D           ----IGERFPEEVTTDHGVKLPDHYVSQGKWFVLFSHPADFTP-VTTEFVSFARRYEDFQRLGVDLIGLS
2e2mC           --PLIGERFPEMEVTTDHGIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLS
2e2mH           ----IGERFPEMEVTTDHGIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLS
2c0dB           ----VTKKAYNFTAQGLNKNVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGIS
2e2mE           --PLIGERFPEMEVTTDHGIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLS
2e2gB           --PLIGERFPEMEVTTDHGVIKLPDVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2e2mA           --PLIGERFPEMEVTTDHGIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLS
2e2mD           ----IGERFPEMEVTTDHGVIKLPDVSQGKWFVLFSHPADFTP-VTTEFVSFARRYEDFQRLGVDLIGLS
2e2gA           --PLIGERFPEMEVTTDHGVIKLPDVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2bmxB           --IGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVS
2e2gC           --PLIGERFPEMEVTTDHGVIKLPDVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2bmxA           -LIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVS
3drnA           --VKVGDKAPLFEGIADNGKISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKDYDVVVIGVS
3drnB           --VKVGDKAPLFEGIADNGKISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKDYDVVVIGVS
2c0dA           ----VTKKAYNFTAQGLNKNVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGIS
1e2yA           -AAKLNHPAPEFDDALPNGKVSLSSYKGKYVVLFF--YPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
2cvbA           -ELPLESPLIDAELPDPRGRYRLSQFHEP---LLAVVFCNHCPYVKGSIGELVALAERY-RGKVAFVGIN
2b7jA           -----PSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNSKYGITLQPLFIT
1e2yG           ----LNHPAPEFDDALPNGKVSLSSYKGKYVVLFF--YPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
2b7jB           --------GGPFHLEDMYGEFTEKNLLGK-FSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPL
3c9dA           -----------------------NEHAKAFLGLAKCEEEVDAIEREVELYRLNKMKPVYEKRDAYIDEIA
1e2yC           -AAKLNHPAPEFDDALPNGKVSLSSY--KGKYVVLFFYPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yE           ---KLNHPAPEFDDALPNGKVSLSSYKGK--YVVLFFYPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yB           ----LNHPAPEFDDALPNGKVSLSSYKGK--YVVLFFYPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
1e2yD           -AAKLNHPAPEFDDALPNGKVSLSSYKGK--YVVLFFYPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
2cx3B           ----LGEKAPDFTLPNQDFPVNLYEVLKRGPAVLIFFPAAFSPVCTKELCTFRDKAQLE-KANAEVLAIS
2cx3A           ----LGEKAPDFTLPNQDFPVNLYEVLKRGPAVLIFFPAAFSPVCTKELCTFRDKAQLEKA-NAEVLAIS
2b7kA           -----PSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNSKYGITLQPLFIT
1e2yH           -AAKLNHPAPEFDDALPNGKVSLSSYKGK--YVVLFFYPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
3dwvA           --MSAASSIFDFEVLDADHKPYNLVQHKGSP-LLIYNVASKCGYTKGGYETATTLYNKYKSQGFTVLAFP
2b5xA           --MKLRQPMPELTGEKAWLNGEVTRELIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQ-LNVVAVH
3cynB           ----MINSFYAFEVKDAKGRTVSLEKYKGKVSLVV-NVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFP
3cynC           -FQSMINSFYAFEVKDAKGTVSLEKYKGKVSLVVN--VASDCQLTDRNYLGLKELHKEFGPSHFSVLAFP
3c71A           --------APNFVLEDTNGRIELSDLKGKGVFLNF--WGTWCPHCKKEFPYMANQYKHFKSQGVEIVAVN
3c73B           --------APNFVLEDTNGRIELSDLKGKGVFLNFWGT--WCEHCKKEFPYMANQYKHFKSQGVEIVAVN
2b7kB           --------GGPFHLEDMYGEFTEKNLLGK-FSIIYFGFSNCPDICPDELDKLGLWLNTLYGITLQPLFIT
1e2yF           ----LNHPAPEFDDALPNGKVSLSSYKGKYVVLFF--YPDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
3cynA           ----MINSFYAFEVKDAKGTVSLEKYKGKVS--LVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFP
3c73A           --------APNFVLEDTNGRIELSDLKGKGVFLNFWG--TWCEHCKKEFPYMANQYKHFKSQGVEIVAVN
2b8aA           --------YPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSE
2b1kA           -SALIGKPVPKFRLESLDNPGQFYQVLTQGKPVLLNVWATWCPTCRAE----HQYLNQLSAQGIRVVGMN
2a4vA           ----IGDPIPDLSLLNEDNSISLKKITENNVVVFFVYPRASTPGSTRQASGFRDNYQELKEYAA-VFGLS
3cmiA           --------FYKLAPVDKKGPFPFDQLKGKVVLIVNVAS---KCGFTPQYKELEALYKRYKDEGFTIIGFP
2dj0A           -----GSSGSSGYIKYFNDK-TIDEELERRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVD
2dlxA           ----ADLFRPPIDLMHKGSFETKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQ
3boaA           ----EAVAPEDSAVVKLATD-SFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQID
2b5eA           --QQEAVAPEDSAVVKLATD-SFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQID
1a8yA           -----GLDFPEYDGVDRVINVNAKNYKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVG
1eejA           APVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFT-DITCGYCHKLHEQMADYNALGITVRYLAFPRQ
3c7mA           -----------FTEGTDYMVLEKPIPNADKTLIKVF--SYACPFCYKYDKAVTGPVSEKVKDIVAFTPFH
2ec4A           ----YGDCHPVFFIGSLEAAFAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWA


                         .         .         *         .         .         .         .:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
2cv4A           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHA-ESATHTVRGVFIVDARGVIRT--LYY
2cv4E           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAE-SATHTVRGVFIVDARGVIRTLYYPE
2cv4D           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAE-SATHTVRGVFIVDARGVIRT--LYY
2e2mC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHA-ESATHTVRGVFIVDARGVIRTMLYYP
2e2mH           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLAE--SATHTVRGVFIVDARGVIRTMLYYP
2c0dB           VDSVYSHLAWKNMIEKGGIGNVEFTLVSDINKDISKNYNVLYD---NSFALRGLFIIDKNGCVRHQTVND
2e2mE           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLAT-----HTVRGVFIVDARGVIRTMLYYP
2e2gB           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHATHTVRGV----FIVDARGVIRTMLYYP
2e2mA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRG-----VFIVDARGVIRTMLYYP
2e2mD           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLAT-----HTVRGVFIVDARGVIRTMLYYP
2e2gA           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHT-----VRGVFIVDARGVIRTMLYYP
2bmxB           IDSEFAHFQWRAQHNDLKTL---PFPLSDIKRELSQAAGVLNA---DGVADRVTFIVDPNNEIQFVSATA
2e2gC           VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLSATHTVRGV----FIVDARGVIRTMLYYP
2bmxA           IDSEFAHFQWRAQHNDL---KTLPFPLSDIKRELSQAAGVLNADGVAD---RVTFIVDPNNEIQFVSATA
3drnA           SDDINSHKRFK------EKYKLPFILVSDPDKKIRELYGAKG----FILPARITFVIDKKGIIRHIYNSQ
3drnB           SDDINSHKRFKEKYK------LPFILVSDPDKKIRELYGAKG----FILPARITFVIDKKGIIRHIYNSQ
2c0dA           VDSVYSHLAWKNMPIEKGIGNVEFTLVSDINKDISKNYNVLYD---NSFALRGLFIIDKNGCVRHQTVND
1e2yA           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDEDS--GVAYRGVFIIDPNGKLRQII-IN
2cvbA           ANDYEKYPEDAPEKAAFAEEHIFFPYLLDETQEVAKAYRALR--------TPEVFLFDERRLLRYHGRVN
2b7jA           CDPARDSPAVLKEYLSDFHPILGLTGTFDEVKNACKKYRVYVD------HSIFFYLMDPEGQFVDALGRN
1e2yG           CDSEYSHLQWTSVDRKKGGLG-PAIPLADKTKAIARAYGVL--DEDSGVAYRGVFIIDPNGKLRQ-IIIN
2b7jB           FITCDPARDSPAVLKEYLSSILGLTGTFDEVKNACKKYRVYFSTPYLVDHSIFFYLMDPEGQFVDALGRN
3c9dA           EFWKIVLS--------------QHVSFANYIRASDFKYID-TIDKIKVEWLALESEMYDTRDFSITFHFH
1e2yC           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLR-QIIIN
1e2yE           CDSEYSHLQWTSVDRKKGGLG-PAIPLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLRQII-IN
1e2yB           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLRQ-IIIN
1e2yD           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDED--SGVAYRGVFIIDPNGKLRQII-IN
2cx3B           VDSPWCLKKFKDENR------LAFNLLSDYNREVIKLYNVYHDLKGLKVAKRAVFIVKPDGTVAYKWVTD
2cx3A           VDSPWCLKKFK------DENRLAFNLLSDYNREVIKLYNVYHEDLKGLKAKRAVFIVKPDGTVAYKWVTD
2b7kA           CDPARDSPAVLKEYLSDFHPSLGLTGTFDEVKNACKKYRVLVD------HSIFFYLMDPEGQFVDALGRN
1e2yH           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLRQ-IIIN
3dwvA           SNQFGGQEPGNEEEFVCTKFKAEFPIMAKINVNGENAHPLYELATKAIKWNFTSFLIDRDGVPVERFSPG
2b5xA           MPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEY--------VPAYYVFDKTGQLRHFQAGG
3cynB           CNQFGESEPRPSESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDEPRWNFWKYLVNPEGQVVKFWRPI
3cynC           CNQFGESEPRPSKEVESFARKVTFPIFHKIKILGSEGEPAFRFSKKEPRWNFWKYLVNPEGQVVKFWRPI
3c71A           VGESKIAVHNF-----MKSYGVNFPVVLDTDRQVLDAYDV--------SPLPTTFLINPEGKVVKVVT-G
3c73B           VGESKIAVHNFMKS-----YGVNFPVVLDTDRQVLDAYDV--------SPLPTTFLINPEGKVVKVVT-G
2b7kB           CDPARDSPAVLKEYLSDFHPSLGLTGTFDEVKNACKKYRVYFSTPPLVDHSIFFYLMDPEGQFVDALGRN
1e2yF           CDSEYSHLQWTSVDRKK-GGLGPAIPLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLRQ-IIIN
3cynA           CNQFGESEPRPSKEVERKNYGVTFPIFHKIKILGSEGEPAFRFLVDSPRWNFWKYLVNPEGQVVKFWRPI
3c73A           VGESKIAVHNFMKSYGV-----NFPVVLDTDRQVLDAYDV--------SPLPTTFLINPEGKVVKVVT-G
2b8aA           GLWEIENNPTVKASG------YQSSQKKSCA---------------------------------------
2b1kA           YKDRQKAISWLKELG------NPYALLFDGDGMLG--LDLGVYG------APETFLIDGNGIIRYRHAGD
2a4vA           ADSVTSQKKFQ------SKQNLPYHLLSDPKREFIGLLGAKKT---PLSGSIRSHFIFVDGKLKFKISPE
3cmiA           CNQFGGVTFPIMKKIDVNG-GNEDPVYKFLKSQKSGMLGLRGIKW-----NFEKFLVDKKGKVYERYSSL
2dj0A           VGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVS------WTFSEENVIREFNLNE
2dlxA           VYHDSEEGQRYIQFYKLGD--FPYVSILDPRTGQKLVEWHQLD--VSSFLDQVTGFLGEHGQL-------
3boaA           CTENQDLCMEH------NIPGFPSLKIFKNSDVNNSIDYEGPRTAE--------AIVQFMIKQSQPAVAV
2b5eA           CTENQDLCMEHNIPG------FPSLKIFKNSDVNNSIDYEGPRTAE--------AIVQFMIKQSQPAVAV
1a8yA           FGLVDSEKDA------------------------------------------------------------
1eejA           GLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADVQLGVSGTPAVVLSNGTLVPGYQ----
3c7mA           LETKGEYGKQ------------------------------------------------------------
2ec4A           WDLTKDSN-------RARFLTMCNRHFGSVVAQTIRTQKT--------DQFPLFLIIMGKRSSNEVL-NV


                         +         .         .         .         .         *         .:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
2cv4A           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARESGQYRCLDWWFCWDTPA
2cv4E           --LGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARESGQYRCLDWWFCWDTPA
2cv4D           PELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIILIVPPPTTEDQARARESGQYRCLDWWFCWDTPA
2e2mC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2e2mH           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2c0dB           LPIGRNVQEVLRTIDSIIHVDTSGEVCPINWKKG------------------------------------
2e2mE           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2e2gB           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESGYRSLDWWFCWDTPA
2e2mA           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2e2mD           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2e2gA           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIGLIVPPPTTEDQARARMESQYRSLDWWFCWDTPA
2bmxB           GSVGRNVDEVLRVLDALQ----SDELCASNWR--------------------------------------
2e2gC           MELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARMESGYRSLDWWFCWDTPA
2bmxA           GSVGRNVDEVLRVLDALQ----------------------------------------------------
3drnA           MNPANHVNEALKALKQIKEEE-------------------------------------------------
3drnB           MNPANHVNEALKALKQIKEEE-------------------------------------------------
2c0dA           LPIGRNVQEVLRTIDSIIHVDTSGEVCP------------------------------------------
1e2yA           DPIGRNVEEVIRLVEALQFVEEH-----------------------------------------------
2cvbA           DNPKDPSKVQSHDLEEPPLKEAPAIGCTIKWRPGNEPEVRIG----------------------------
2b7jA           YDEKTGVDKIVEHVKSYVPAE-------------------------------------------------
1e2yG           DPIGRNVEEVIRLVEALQFVEEHGEVCPANWK--------------------------------------
2b7jB           YDEKTGVDKIVEHVKSYVPA-EQRAKQKEAWY--------------------------------------
3c9dA           GIEGDFKEQQVTKVFQIKKDGITSEPVPIEWPQSYD-SINPDLIKDKRSPEGKKKYRQGMKTIFGWFRWT
1e2yC           DPIGRNVEEVIRLVEALQFVEEHGEVCP------------------------------------------
1e2yE           DPIGRNVEEVIRLVEALQFVE-------------------------------------------------
1e2yB           DPIGRNVEEVIRLVEALQFVEEHGEVCPAN----------------------------------------
1e2yD           DPIGRNVEEVIRLVEALQFVEEH-----------------------------------------------
2cx3B           NPLNEDYDEVVREANKIA----------------------------------------------------
2cx3A           NPLNEDYDEVVREANKIA----------------------------------------------------
2b7kA           YDEKTGVDKIVEHVKSYV----------------------------------------------------
1e2yH           DPIGRNVEEVIRLVEALQFVEEH-----------------------------------------------
3dwvA           ASVKDIEEKLIPLL--------------------------------------------------------
2b5xA           SGMKMLEKRVNRVLAETE----------------------------------------------------
3cynB           EVIRPDIAALVRQVIIKKKED-------------------------------------------------
3cynC           EVIRPDIAALVRQVIIKKKED-------------------------------------------------
3c71A           TMTESMIHDYMNLIKPGETS--------------------------------------------------
3c73B           TMTESMIHDYMNLIKPGE----------------------------------------------------
2b7kB           YDEKTGVDKIVEHVKS------------------------------------------------------
1e2yF           DPIGRNVEEVIRLVEALQF---------------------------------------------------
3cynA           EVIRPDIAALVRQVIIKKKED-------------------------------------------------
3c73A           TMTESMIHDYMNLIK-------------------------------------------------------
2b8aA           ----------------------------------------------------------------------
2b1kA           LNPRVWEEEIKPLWEKYS----------------------------------------------------
2a4vA           VSVNDAKKEVLEVAEKFK----------------------------------------------------
3cmiA           TKPSSLSETIEELLKEV-----------------------------------------------------
2dj0A           LS--------------------------------------------------------------------
2dlxA           ----------------------------------------------------------------------
3boaA           VADLPAYLANET----------------------------------------------------------
2b5eA           VAD-------------------------------------------------------------------
1a8yA           ----------------------------------------------------------------------
1eejA           --PPKEMKEFLD----------------------------------------------------------
3c7mA           ----------------------------------------------------------------------
2ec4A           IQGNTTVDELMMRLMAA-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NK
2cv4A           SR
2cv4E           SR
2cv4D           SR
2e2mC           SR
2e2mH           SR
2c0dB           --
2e2mE           SR
2e2gB           SR
2e2mA           SR
2e2mD           SR
2e2gA           SR
2bmxB           --
2e2gC           SR
2bmxA           --
3drnA           --
3drnB           --
2c0dA           --
1e2yA           --
2cvbA           --
2b7jA           --
1e2yG           --
2b7jB           --
3c9dA           --
1e2yC           --
1e2yE           --
1e2yB           --
1e2yD           --
2cx3B           --
2cx3A           --
2b7kA           --
1e2yH           --
3dwvA           --
2b5xA           --
3cynB           --
3cynC           --
3c71A           --
3c73B           --
2b7kB           --
1e2yF           --
3cynA           --
3c73A           --
2b8aA           --
2b1kA           --
2a4vA           --
3cmiA           --
2dj0A           --
2dlxA           --
3boaA           --
2b5eA           --
1a8yA           --
1eejA           --
3c7mA           --
2ec4A           --