[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57898.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dumC.bssp"
#ERROR : Can't open dsspfile "2dumA.bssp"
#ERROR : Can't open dsspfile "3cisF.bssp"
#ERROR : Can't open dsspfile "3cisE.bssp"
#ERROR : Can't open dsspfile "3cisG.bssp"
#ERROR : Can't open dsspfile "3cisC.bssp"
#ERROR : Can't open dsspfile "3cisB.bssp"
#ERROR : Can't open dsspfile "3cisH.bssp"
#ERROR : Can't open dsspfile "3dloA.bssp"
#ERROR : Can't open dsspfile "3cisA.bssp"
#ERROR : Can't open dsspfile "2dumD.bssp"
#ERROR : Can't open dsspfile "2dumB.bssp"
#ERROR : Can't open dsspfile "3dloD.bssp"

## Summary of PDB Search
:152
    3e-17  22%  2dumC  [x.x.x] HYPOTHETICAL PROTEIN PH0823
    6e-17  23%  2dumA  [x.x.x] HYPOTHETICAL PROTEIN PH0823
    1e-15  20%  3cisF  [x.x.x] UNCHARACTERIZED PROTEIN
    6e-15  18%  3cisE  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-14  20%  3cisG  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-14  20%  3cisC  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-14  18%  3cisB  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-14  20%  3cisH  [x.x.x] UNCHARACTERIZED PROTEIN
    8e-14  24%  3dloA  [x.x.x] UNIVERSAL STRESS PROTEIN
    2e-13  20%  3cisA  [x.x.x] UNCHARACTERIZED PROTEIN
    5e-13  21%  2dumD  [x.x.x] HYPOTHETICAL PROTEIN PH0823
    5e-11  20%  2dumB  [x.x.x] HYPOTHETICAL PROTEIN PH0823
    1e-10  24%  3dloD  [x.x.x] UNIVERSAL STRESS PROTEIN
:152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIIEDIIVTVDGSENXXXXXXXXXXXXXXXXNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQL
2dumC           -------MFRKVLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMDL------KDIKEKL
2dumA           -------MFRKVLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMEL------KDIKEKL
3cisF           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWPGIDWPATQSMAEQVL
3cisE           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWP-----GIDWPATQSM
3cisG           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWPGIDWPATQSMAEQVL
3cisC           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWPGIDWPATQSMAEQVL
3cisB           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDV-----DVSEWPGIDWPATQSM
3cisH           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWPGIDWPATQSMAEQVL
3dloA           --------------------------------------------------------VHSLPGGGRTKDED
3cisA           -----------VLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVDVSEWPGIDWPATQSMAEQVL
2dumD           -----------VLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMDGLKDIKEKLKEE--
2dumB           -----------VLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELMDGYKDIKEKLK----
3dloD           ------------------------------------------------------------LPGGGRTKDE


                         .         .         *         .         .         .         .:140
query           KKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVIGRRGLSRFEALLLGSVSEKV
2dumC           KEEASRKLQEKAEEVKRAFRKNVRTIIRFGIPWDEIVKVAEEENVSLIILPSRGKLSLSHEFLGSTVMRV
2dumA           KEEASRKLQEKAEEVKRARAKNVRTIIRFGIPWDEIVKVAEEENVSLIILPSRG--KLSHEFLGSTVMRV
3cisF           A-ERLAGWQERYPNV------AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
3cisE           AEQVLAERLAGWQERYPNV--AITRVVVRDQPARQLVQRSEEA--QLVVVGSRGRGGYAGMLVGSVGETV
3cisG           A-ERLAGWQERYPNV------AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
3cisC           A-ERLAGWQERYPNV------AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
3cisB           AEQVLAERLAGWQERYPNV--AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
3cisH           A-ERLAGWQERYPNV------AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
3dloA           IIE-AKETLSWAVSIIRKEGAEGEEHVRGKEPPDDIVDFADEVDAIAIVIGIRKRSPTGKLIFGSVARDV
3cisA           AERLAG-WQERYPNV------AITRVVVRDQPARQLVQRSEE--AQLVVVGSRGRGGYAGMLVGSVGETV
2dumD           ----ASRKLQEKAEEVKRAFRAKNVRIRFGIPWDEIVKVAEEENVSLIILPSRGKHE----FLGSTVMRV
2dumB           --EEASRKLQEKAEEVKRAFRAKNVRIRFGIPWDEIVKVAEEENVSLIILPSRHE------FLGSTVMRV
3dloD           DIIEAKETLSWAVSIIRKEEGEEHLLVRGKEPPDDIVDFADEVDAIAIVIGIRGKL-----IFGSVARDV


                         +         .         .         .         .         *         .:210
query           VRHASGPVTIIH
2dumC           LRKTKKPVLIIK
2dumA           LRKTKKPVLIIK
3cisF           AQLARTPVIVAR
3cisE           AQLARTPVIVAR
3cisG           AQLARTPVIVAR
3cisC           AQLARTPVIVAR
3cisB           AQLARTPVIVAR
3cisH           AQLARTPVIVAR
3dloA           ILKANKPVICI-
3cisA           AQLARTPVIVAR
2dumD           LRKTKKPVLIIK
2dumB           LRKTKKPVLIIK
3dloD           ILKANKPVICI-