[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA57987.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ee7B.bssp"
#ERROR : Can't open dsspfile "3a43B.bssp"

## Summary of PDB Search
:397
    1e-12   8%  3ee7B  [x.x.x] REPLICASE POLYPROTEIN 1A
    2e-04  16%  3a43B  [x.x.x] HYDROGENASE NICKEL INCORPORATION PROTEIN HYPA
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ee7B           ----------------------------------------------------------------------
3a43B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxKKGYPRFKRKRGKQSSYHCMSVSCGESWVKVPKLGPIKARVHRSV
3ee7B           -------------------------LRQMSCAAGTTQDDNALAYYNNSKGGR-FVLALLSHQDLKWARFK
3a43B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGKLKSITLSRTVTGKHYASLLYETEQPVPEPMTAIDATKVLGLDMGLSHLAIDSTGRKVANPRFxxxxx
3ee7B           SDGTGTIYTELEPPCRFVTDTPKGPKVKYLYF-----IKGLNNLNRGMVLESLAATV-RLQLEHH-----
3a43B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVIVETLKVNNMMKNA
3ee7B           ----------------------------------------------------------------------
3a43B           ------------------------------------------------------RTVLDYAQREGASRVK


                         .         *         .         .         .         .         +:350
query           KLAKHIGDASWHALIAKLAYKAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDR
3ee7B           ----------------------------------------------------------------------
3a43B           AVRVVLGELQDVAEDIKFAMEQLFAGTIAEGAEIEFVEEEACRNCNYEW---KLKEVKLACPKCGSHDFE


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ee7B           -----------------------------------------------
3a43B           -----------------------------------------------