[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58119.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eevC.bssp"
#ERROR : Can't open dsspfile "3bfpA.bssp"
#ERROR : Can't open dsspfile "3bswA.bssp"
#ERROR : Can't open dsspfile "3eevB.bssp"
#ERROR : Can't open dsspfile "3eevA.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "3cj8A.bssp"
#ERROR : Can't open dsspfile "3ectA.bssp"
#ERROR : Can't open dsspfile "1ci7A.bssp"
#ERROR : Can't open dsspfile "3cj8C.bssp"
#ERROR : Can't open dsspfile "2aq9A.bssp"
#ERROR : Can't open dsspfile "3bsyA.bssp"
#ERROR : Can't open dsspfile "3eg4A.bssp"
#ERROR : Can't open dsspfile "3bxyA.bssp"
#ERROR : Can't open dsspfile "3c8vC.bssp"
#ERROR : Can't open dsspfile "3eh0A.bssp"
#ERROR : Can't open dsspfile "3cj8B.bssp"
#ERROR : Can't open dsspfile "3dk5A.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "3c8vB.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "2eg0A.bssp"
#ERROR : Can't open dsspfile "3c8vA.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "2eg0B.bssp"
#ERROR : Can't open dsspfile "3b8yA.bssp"

## Summary of PDB Search
:258
    5e-26  13%  3eevC  [x.x.x] CHLORAMPHENICOL ACETYLTRANSFERASE
    1e-22  14%  3bfpA  [x.x.x] ACETYLTRANSFERASE
    3e-21  16%  3bswA  [x.x.x] ACETYLTRANSFERASE
    7e-21  14%  3eevB  [x.x.x] CHLORAMPHENICOL ACETYLTRANSFERASE
    8e-21  14%  3eevA  [x.x.x] CHLORAMPHENICOL ACETYLTRANSFERASE
    9e-20  14%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-18  17%  3cj8A  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-
    1e-16  19%  3ectA  [x.x.x] HEXAPEPTIDE-REPEAT CONTAINING-ACETYLTRANSFERASE
    3e-15   8%  1ci7A  [d.117.1] PROTEIN (THYMIDYLATE SYNTHASE)
    1e-14  17%  3cj8C  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-
    1e-14  12%  2aq9A  [x.x.x] ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-
    1e-12  14%  3bsyA  [x.x.x] ACETYLTRANSFERASE
    1e-12   9%  3eg4A  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2,6-DICARBOXYLATE N-
    2e-12  15%  3bxyA  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2,6-DICARBOXYLATE N-
    9e-12   6%  3c8vC  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    3e-11  12%  3eh0A  [x.x.x] UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-
    1e-10  19%  3cj8B  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-
    1e-09  22%  3dk5A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-09   9%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    3e-09   9%  3c8vB  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-08   6%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    8e-08  20%  2eg0A  [x.x.x] HYPOTHETICAL CONSERVED PROTEIN
    3e-07  10%  3c8vA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    6e-07  12%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  11%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-06  21%  2eg0B  [x.x.x] HYPOTHETICAL CONSERVED PROTEIN
    1e-04  11%  3b8yA  [x.x.x] ENDO-PECTATE LYASE
:258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHP
3eevC           -----------NFFTSPFSGIPLDQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGS
3bfpA           --------------EDVAKNMGYKECIFLDSTLPKYDFFIAIGNNEIRKKIYQKISENGFKI--VNLIHK
3bswA           -------YKECIFLDDFKGMKFESTLPKYDFFIAIGNNEIRKKIYQKISENGFKI---------VNLIHK
3eevB           -----------NFFTSPFSGIPLDQQVTNPNII-VGKHSYYSGYYHGHSF-----DDCVRYLHPERDDVD
3eevA           ------------FFTSPFSGIPLDQQVTNPNIIV------GKHSYYSGYYHGHSFDDCVRYLHPERDDVD
3d8vA           TVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADG
3cj8A           ----------ADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIGA
3ectA           -----------------------AEIEALRSQAGRLKLEINQSLDEAERYALQREL--------FGHLGH
1ci7A           ----IQKIRTSPYDRRLILSAWNPADLEKMALPPCHMFCQFYVHIPSRPELSCQLYQRSCDMGLGVPFNI
3cj8C           ----------ADVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIGA
2aq9A           -------------------------------EIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIH
3bsyA           ---------------DVAKNMGYKECIFLDDFKGMKFESTLPKYDFFIAIGNNEIRKKIYQKIIVNLIHK
3eg4A           ----------------------------GAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQ
3bxyA           ----LKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLM
3c8vC           --------LDNAWGKGSNAQENCYIINSRLERNCVTAHGGKIINAHLGDIFTGFNSFLQGSESSPLKIGD
3eh0A           ----------------------------------------------------------------ITFMVN
3cj8B           -------------------------------DARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIGA
3dk5A           -------------------------------------------------------------------LRP
1cp9B           ---------------ATALTFRENNFFGIPQALPQENF---HQNEYHNRGTENDLIVFTEEGVSAWDVVA
3c8vB           ----------------------------------------------------------------------
3brkX           CVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS
2eg0A           -------------------------------------------------------------------KGK
3c8vA           -------------------------------INSRLERNCVTAHGGKIINAHLGDIFTGFNSFLQGSESS
3d98A           ---------ILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDV
3dj4A           WIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTY
2eg0B           -------------------------------------------------------------------KGK
3b8yA           CEDAATNNGKTMTIVGGIAHNAKDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVT


                         .         .         *         .         .         .         .:140
query           GAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTXXXXXXXXXXXXXXXPIHIGS
3eevC           FCSIGSGAVFMMGNQGHRSDWISTFPFFYQDNDNFADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGH
3bfpA           SALISPSAIVEENAGILIMPYVVINAKAKIEKGVILNTSSVAKCAGNVKIGKNCFLGINSCVLPNLSLAD
3bswA           SALISPSAIVEENAGILIMPYVVINAKAKIEKGVILNTSSVAKCAGNVKIGKNCFLGINSCVLPNLSLAD
3eevB           KLVIGSFCSIGSGVFMMAGNQGHRSDWISTFPFFYQDNDNFFTRSGDTIIGHDVWIGTEAMIMPGVKIGH
3eevA           KLVIGSFCSIGSGVFMMAGNQGHRSDWISTFPFFYQDNDNFADARDGFIIGHDVWIGTEAMIMPGVKIGH
3d8vA           KLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNKRRTTVGSHVRTGSDTMFVAPVTIGD
3cj8A           ILNIGAVVGAGTIDGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGE
3ectA           KSCVQPPFHCEFGKTIRIGDHTFINNVVLDGAPITIGRQAWETICKPIVIEDDVWIGGNVVINQGVTIGA
1ci7A           ASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQ--LTRSPRPFPTLSLNRSITDIEDFTLDD
3cj8C           ILNIGAVVGAGTIDGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGE
2aq9A           RGTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQ--FCIIGA
3bsyA           SALISPSAIVEENAGILIMPYVVINAKAKIEKGVILNTSSVIKCAGNVKIGKNCFLGINSCVLPNLSLAD
3eg4A           AGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGVDRATGEVFYGEVPPYSVVVAGTMPGKNVPGEN
3bxyA           PSYVNIGAYVDEGTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVYIGQ
3c8vC           GCVVPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTGRTFRGKGGPFLDSFKKRI
3eh0A           PKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGN
3cj8B           ILNIGAVVGAGTIDGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGE
3dk5A           GTALGADGKLGAFVGTKVPHLTYVG-DADIGEYSNIGASSVFVNKRRTTVGSHVRTGSDTMFVAPVTIGD
1cp9B           PGQSGFISPQGKP---------------------------------------------------------
3c8vB           -----------LERNCVTAHGGKIINAHLGDIFTGFNSFLQGSESSPLKIGDGCVVPHTIIDLEELEIPA
3brkX           VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHLSNVVIDHGVVIPEGLIVGEDPELDA
2eg0A           TPQIAASAFIAD--YVTITGDVVIGEETSIWFNTVIRGDVAPQSPNNPLIIEDGVTVGHQVILHSAIVRK
3c8vA           PLKIGDGCVVPHTI-IDLEEPLEIPAGHLVWGYIRNKADLA---AHSISFEEFAKVDGEVTGRTFRGKGG
3d98A           DVTIGRDTVIHPG--TQLLGRTQIGGRCVVGPDTTLTDVAVGDGGSSSSIGDGAAVGPFTYLRPGTALGA
3dj4A           LRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYVNRTTVGSHVRTGSDTMFVAPVTIGD
2eg0B           TPQIAASAFIADY--VTITGDVVIGEETSIWFNTVIRGSILHQSPNNPLIIEDGVTVGHQVILHSAIVRK
3b8yA           SATVNGTIDSIAGVNRNYGDVATISGLKEGKPPVCEEFKGVVKGQGSTEKYG------------EKWDTT


                         +         .         .         .         .         *         .:210
query           GVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIE
3eevC           GAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWWNWPESWLKESMQSLCSSDIEGLYL
3bfpA           DSILGGGATLVKNQDEKGVFVGVPAKRM------------------------------------------
3bswA           DSILGGGATLVKNQDEKGVFVGVPAKRM------------------------------------------
3eevB           GAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWWNWPESWLKESMQSLCSSDIEGLYL
3eevA           GAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWWNWPESWLKESMQSLCSSDIEGLYL
3d8vA           GAYTGAGTVVREDVPPGLAVSAGPQRNIEN----------------------------------------
3cj8A           GAVVAAGAVVVEDVPAHTVVAGVPAKVI------------------------------------------
3ectA           RSVVAANSVVNQDVPPDTLVGGTPARIL------------------------------------------
1ci7A           FNIQNYHPYET-----------------------------------------------------------
3cj8C           GAVVAAGAVVVEDVPAHTVVAGVPAKVI------------------------------------------
2aq9A           HVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFREAITAIRNAYKLIYRSGKTLDEVKPEIAE
3bsyA           DSILGGGATLVKNQDEKGVFVGVPAKRM------------------------------------------
3eg4A           WGPSLYCAVIVKRADEKTRSKTSINELL------------------------------------------
3bxyA           STRIYDRDIHYGRVPAGSVVVNLPSK--------------------------------------------
3c8vC           KRILSENGAFFDGSEGTGHAQKNFTFNIIQ----------------------------------------
3eh0A           NVSIGANAVIESGVELGDNVII------------------------------------------------
3cj8B           GAVVAAGAVVVEDVPAHTVVAGVPAKVI------------------------------------------
3dk5A           GAYTGAGTVVREDVPPGALAVAGPQRNIENWVQRKRPGSPA-----------------------------
1cp9B           ----------------------------------------------------------------------
3c8vB           GHLVWGYIRNKADLAAHSISFEEFAKVDG--------------EVTGRTFRGKGGPFLDSFKKRIKRILS
3brkX           KRFRRTESGIC----------LITQSIDK-----------------------------------------
2eg0A           NALIGMGSIILKKIPPNTLALGRPAKVV------------------------------------------
3c8vA           PFLDSFKKRIKRILSENTFNIIQPYQDG------------------------------------------
3d98A           DGKLGAFVEVKNSTIGTGTKVPHLTY--------------------------------------------
3dj4A           GAYTGAGTVVREDVPPGALAVAGPQRNI------------------------------------------
2eg0B           NALIGMGSIILKKIPPNTLALGRPAKVVRTEDDIRE----------------------------------
3b8yA           NCKVSRSGVS------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HIQRLDERIEQMTAEIKNLGGDLxxxxxxxxxxxxxxxxxxxxxxxxx
3eevC           NWQSKA------------------------------------------
3bfpA           ------------------------------------------------
3bswA           ------------------------------------------------
3eevB           NWQ---------------------------------------------
3eevA           NWQ---------------------------------------------
3d8vA           ------------------------------------------------
3cj8A           ------------------------------------------------
3ectA           ------------------------------------------------
1ci7A           ------------------------------------------------
3cj8C           ------------------------------------------------
2aq9A           LAE-TYPEVKAFTDFFAR------------------------------
3bsyA           ------------------------------------------------
3eg4A           ------------------------------------------------
3bxyA           ------------------------------------------------
3c8vC           ------------------------------------------------
3eh0A           ------------------------------------------------
3cj8B           ------------------------------------------------
3dk5A           ------------------------------------------------
1cp9B           ------------------------------------------------
3c8vB           ENGAFFDGSEGTGHAQKNFTFNI-------------------------
3brkX           ------------------------------------------------
2eg0A           ------------------------------------------------
3c8vA           ------------------------------------------------
3d98A           ------------------------------------------------
3dj4A           ------------------------------------------------
2eg0B           ------------------------------------------------
3b8yA           ------------------------------------------------