[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58132.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2arhB.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"

## Summary of PDB Search
:206
    4e-12  16%  1e2mA  [c.37.1] THYMIDINE KINASE
    5e-12  17%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    3e-11  17%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    7e-10  15%  1e2iA  [c.37.1] THYMIDINE KINASE
    8e-10  15%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-09  15%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-09  14%  1e2lA  [c.37.1] THYMIDINE KINASE
    2e-09  16%  2c95B  [x.x.x] ADENYLATE KINASE 1
    3e-09  21%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-08  13%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    8e-08  16%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    2e-07  14%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-06  12%  1e2kB  [c.37.1] THYMIDINE KINASE
    5e-06  22%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-05  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    8e-05   8%  2arhB  [x.x.x] HYPOTHETICAL PROTEIN AQ_1966
    2e-04  18%  1e2nA  [c.37.1] THYMIDINE KINASE
    3e-04  13%  1e2mB  [c.37.1] THYMIDINE KINASE
    0.001  28%  2cckA  [x.x.x] THYMIDYLATE KINASE
:206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
1e2mA           -IDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQRLDQGEISAGDAAVVMTYAVTDA
2a2zA           -IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSTFQTYACLSRIRAQLA
2a2zB           -IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQL
1e2iA           -IDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGD-AAVVMTSAQITMGMPYA
1e2jA           -IDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRSAGDAAVVMTSANITMGMPYA
1e2hA           YIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHISAGDAAVVMTSAQITMGMPYA
1e2lA           -IDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGAANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYA
2c95B           -VVGGPGSGKGTQCEKIVQKYGYTHLST-------GDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLD
2cdnA           -LLGPPGAGKGTQAVKLAEKLG-------IPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNE
2a2zD           -IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQL
2a30B           -IEGNIAAGKSTFVNILKWEVVPEPVARWC----NVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLA
1e2kA           -IDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYQGEISAGDAAVVMTSAQITMGMPYA
1e2kB           -IDGPHGMGKTTTTQLLVALGSYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAPYA
2ccgB           ---GPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLV
1e2lB           -IDGPHGMGKTTTTQLLVALGSRDDEPMTYWRVLGASETIANIFTTQHRLDQGEISAGTSAQITMGMPYA
2arhB           ------TLENGINSEGEIRLVRKSQKEEFNFDLSLGSKPLLTLKVFLGRKPY--------------WQPW
1e2nA           -IDGPHGMGKTTTTQLLVALGSRDDEPMTYWRVLGASETIANIYTTQRLDQGEISAGDAAVVMPYAVTDA
1e2mB           -IDGPHGMGKTTTTQLLVALGSRDDIVYVYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAAVL
2cckA           -FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEA-----MLFAASRRE


                         .         .         *         .         .         .         .:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
1e2mA           VLAPHIGGEAGSPLTLIFDRHPIAALLCYPLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
2a2zA           SLNGKEKPVLFFERSVYSDRYIFASNLYESECWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRI
2a2zB           ASLNGEKPVLFFERSVYSDRYIFASNLYESECMNEIYQDWHDWNNQFGQSLELDGIIYLQATPETCLHRI
1e2iA           VTDAVLAPGPPPALTLIFDRHPIAALLCYLMGSMTPQAVLAFVA-LIPPTLPGTNIVLGALPEDRHIDRL
1e2jA           VTDAVLAPHIGGALTLIFDRHPIAALLCYPLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
1e2hA           VTDAVLAPHIGGALTLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
1e2lA           VTDAVLAPHIGGEAGLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
2c95B           MLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRI---------------GQPTLLLYVDAGPETMTQRL
2cdnA           LVDDRLNNPDAANGFILDGYPRSVEQAKAL------------HEMLERRGTDIDAVLEFRVSEEVLLERL
2a2zD           A---SLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYNNQFGQSLELDGIIYLQATPETCLHRI
2a30B           SLNDAEKPVLFFERSVYSDRYIFASNLYESECMTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRI
1e2kA           VTDAVLAPHIGGELTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRH
1e2kB           VTDAVLAPHIGGEAHAPPPALTLIFDRHRYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
2ccgB           LKV---IPALKEGKVVLCDRYIDSSLAYQGYARGIGVE-EVR----AL-NEFAINGLYPDLTIYLNVSEV
1e2lB           VTDAVLAPHIGGELTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
2arhB           VEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEY-----FEDKETTYELQKGVPPALSRLGFELLK
1e2nA           VLAPHIGGEAPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRH
1e2mB           APHIGGEAGSPPALTLIFDRHPIAALLCYPAAGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
2cckA           HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDL----TIYLNVSAEVG


                         +         .         .         .         .         *         .:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEENRDx
1e2mA           AKRQ---RPGERLDLAMLAAIRRVYGLLANRYLQCGGWGQLSGPRPHIGDTLFTLAPELLAPNGD-
2a2zA           YLRGRNLEYLEKLHYKHWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST----
2a2zB           YLRGRNEEQGIHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST----
1e2iA           AKRQ---RPGERLDLAMLAAIRVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFRALLAPNGD-
1e2jA           AKRQ---RPGERLDLAMLAAIRRVYGLLA-------------------------------------
1e2hA           AKRQ---RPGERLDLAMLAAIRRVYGLLA-------------------------------------
1e2lA           AKRQ---RPGERLDLAMLAAIRRVYGLLA-------------------------------------
2c95B           LKRG-ETSGRVDDNEETIKKRLETYYKATEPVIAFYEKVNAEGSVDSVFSQVCTHLDALL------
2cdnA           KGRGRADDTDDVIL-NRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRAL----------
2a2zD           YLRGRNEQGIPLEYLEKLHYKHTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST----
2a30B           YLRGRNEEQGIHYKHESWLLHRTLKTNFDYLQEVPILTLDV----NEYESLVEK-VKEFLST----
1e2kA           IDRAKRQRPGERLDLAMLAAIRRVYGLLANTVREDWGQLSGTGPRPHIGDTLFTLF----------
1e2kB           AKRERRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPQSNAGPR----------------------
2ccgB           GRERIIKNSLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK----
1e2lB           AKRL-DLAMLAAIRRVYGLLANTVRYSWREDWGQLSGPQSNAGPRPHIGDTLFTLF----------
2arhB           LGYTYFRDWF--------------------------------------------------------
1e2nA           IDRLAKRRPGERLDLAMLAAIRRVYGLLA-------------------------------------
1e2mB           AKRLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRA----
2cckA           RERIIKNSRLDQEDLKFHEKVIEGYQEIIRFK-----SVNADQPLENVVEDTYQTIIKYLEK----