[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bk2A.bssp"
#ERROR : Can't open dsspfile "2bg8B.bssp"
#ERROR : Can't open dsspfile "2cbnA.bssp"
#ERROR : Can't open dsspfile "2bc2A.bssp"
#ERROR : Can't open dsspfile "3dh8A.bssp"
#ERROR : Can't open dsspfile "3bk1A.bssp"
#ERROR : Can't open dsspfile "2bg8A.bssp"
#ERROR : Can't open dsspfile "2bfzA.bssp"
#ERROR : Can't open dsspfile "2bgaA.bssp"
#ERROR : Can't open dsspfile "1bmiB.bssp"
#ERROR : Can't open dsspfile "1bmiA.bssp"
#ERROR : Can't open dsspfile "2bg2A.bssp"
#ERROR : Can't open dsspfile "2bc2B.bssp"
#ERROR : Can't open dsspfile "1bvtA.bssp"
#ERROR : Can't open dsspfile "3bc2A.bssp"
#ERROR : Can't open dsspfile "2bg2B.bssp"
#ERROR : Can't open dsspfile "2bg7B.bssp"
#ERROR : Can't open dsspfile "1dd6B.bssp"
#ERROR : Can't open dsspfile "2bg7A.bssp"
#ERROR : Can't open dsspfile "2bfkA.bssp"
#ERROR : Can't open dsspfile "1dd6A.bssp"
#ERROR : Can't open dsspfile "1a8tA.bssp"
#ERROR : Can't open dsspfile "2bflA.bssp"
#ERROR : Can't open dsspfile "2bflB.bssp"
#ERROR : Can't open dsspfile "2bfkB.bssp"
#ERROR : Can't open dsspfile "1a7tA.bssp"
#ERROR : Can't open dsspfile "1a8tB.bssp"
#ERROR : Can't open dsspfile "1bc2A.bssp"
#ERROR : Can't open dsspfile "1dxkA.bssp"
#ERROR : Can't open dsspfile "1bmcA.bssp"
#ERROR : Can't open dsspfile "2az4B.bssp"
#ERROR : Can't open dsspfile "2bfzB.bssp"
#ERROR : Can't open dsspfile "2az4A.bssp"
#ERROR : Can't open dsspfile "3bv6A.bssp"
#ERROR : Can't open dsspfile "1e5dA.bssp"
#ERROR : Can't open dsspfile "2e7yB.bssp"
#ERROR : Can't open dsspfile "2br6A.bssp"
#ERROR : Can't open dsspfile "3dabA.bssp"
#ERROR : Can't open dsspfile "3bv6B.bssp"
#ERROR : Can't open dsspfile "3dhaA.bssp"
#ERROR : Can't open dsspfile "2d0oD.bssp"
#ERROR : Can't open dsspfile "2a7mA.bssp"
#ERROR : Can't open dsspfile "2bibA.bssp"
#ERROR : Can't open dsspfile "2btnA.bssp"
#ERROR : Can't open dsspfile "2d0oB.bssp"
#ERROR : Can't open dsspfile "2dkfA.bssp"
#ERROR : Can't open dsspfile "2d0pB.bssp"
#ERROR : Can't open dsspfile "2d0pD.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "2e7yA.bssp"
#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2a0wA.bssp"

## Summary of PDB Search
:212
    2e-26  16%  3bk2A  [x.x.x] METAL DEPENDENT HYDROLASE
    4e-26  17%  2bg8B  [x.x.x] BETA-LACTAMASE II
    9e-26  15%  2cbnA  [x.x.x] RIBONUCLEASE Z
    1e-25  19%  2bc2A  [d.157.1] METALLO BETA-LACTAMASE II
    2e-25  25%  3dh8A  [x.x.x] UNCHARACTERIZED PROTEIN PA1000
    3e-25  18%  3bk1A  [x.x.x] METAL DEPENDENT HYDROLASE
    8e-25  20%  2bg8A  [x.x.x] BETA-LACTAMASE II
    1e-24  18%  2bfzA  [x.x.x] BETA-LACTAMASE II
    1e-24  21%  2bgaA  [x.x.x] BETA-LACTAMASE II
    2e-24  16%  1bmiB  [d.157.1 (2bmiB)] METALLO-BETA-LACTAMASE
    3e-24  17%  1bmiA  [d.157.1 (2bmiA)] METALLO-BETA-LACTAMASE
    3e-24  19%  2bg2A  [x.x.x] BETA-LACTAMASE II
    4e-24  18%  2bc2B  [d.157.1] METALLO BETA-LACTAMASE II
    7e-24  19%  1bvtA  [d.157.1] PROTEIN (BETA-LACTAMASE)
    7e-24  18%  3bc2A  [x.x.x] METALLO BETA-LACTAMASE II
    7e-24  20%  2bg2B  [x.x.x] BETA-LACTAMASE II
    1e-23  18%  2bg7B  [x.x.x] BETA-LACTAMASE II
    2e-23  16%  1dd6B  [d.157.1] IMP-1 METALLO BETA-LACTAMASE
    2e-23  20%  2bg7A  [x.x.x] BETA-LACTAMASE II
    5e-23  19%  2bfkA  [x.x.x] BETA-LACTAMASE II
    5e-23  16%  1dd6A  [d.157.1] IMP-1 METALLO BETA-LACTAMASE
    7e-23  19%  1a8tA  [d.157.1] METALLO-BETA-LACTAMASE
    8e-23  18%  2bflA  [x.x.x] BETA-LACTAMASE II
    1e-22  19%  2bflB  [x.x.x] BETA-LACTAMASE II
    1e-22  20%  2bfkB  [x.x.x] BETA-LACTAMASE II
    1e-22  18%  1a7tA  [d.157.1] METALLO-BETA-LACTAMASE
    2e-22  17%  1a8tB  [d.157.1] METALLO-BETA-LACTAMASE
    2e-22  18%  1bc2A  [d.157.1] METALLO-BETA-LACTAMASE II
    3e-22  19%  1dxkA  [d.157.1] CLASS B BETA-LACTAMASE
    3e-22  19%  1bmcA  [x.x.x] METALLO-BETA-LACTAMASE
    3e-22  10%  2az4B  [x.x.x] HYPOTHETICAL PROTEIN EF2904
    5e-22  20%  2bfzB  [x.x.x] BETA-LACTAMASE II
    2e-20  10%  2az4A  [x.x.x] HYPOTHETICAL PROTEIN EF2904
    5e-19  14%  3bv6A  [x.x.x] METAL-DEPENDENT HYDROLASE
    1e-18  13%  1e5dA  [d.157.1 - c.23.5] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
    1e-18  17%  2e7yB  [x.x.x] TRNASE Z
    1e-18  19%  2br6A  [x.x.x] AIIA-LIKE PROTEIN
    1e-17  18%  3dabA  [x.x.x] MDM4 PROTEIN
    1e-17  14%  3bv6B  [x.x.x] METAL-DEPENDENT HYDROLASE
    1e-17  15%  3dhaA  [x.x.x] N-ACYL HOMOSERINE LACTONE HYDROLASE
    4e-17  12%  2d0oD  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    9e-17  15%  2a7mA  [x.x.x] N-ACYL HOMOSERINE LACTONE HYDROLASE
    2e-15  12%  2bibA  [x.x.x] TEICHOIC ACID PHOSPHORYLCHOLINE ESTERASE/
    2e-15  20%  2btnA  [x.x.x] AIIA-LIKE PROTEIN
    4e-13  10%  2d0oB  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    5e-13  18%  2dkfA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    1e-12  11%  2d0pB  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    9e-12  10%  2d0pD  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    9e-12  17%  2cg2A  [x.x.x] SDSA1
    1e-09  15%  2e7yA  [x.x.x] TRNASE Z
    6e-08  20%  2cg3A  [x.x.x] SDSA1
    2e-07  19%  2cfzA  [x.x.x] SDSA1
    4e-07  19%  2cfuA  [x.x.x] SDSA1
    6e-05  16%  2a0wA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
3bk2A           VEIIPLGGGEIGKNITVFRFR--DEIFVLDGGDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLP
2bg8B           WVHTELGSEAVPSNGLVLNTS--KGLVLVDSSLTKELIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2cbnA           MNLIFLPTRTRNVTAILLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLC
2bc2A           WVHTELGSEAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
3dh8A           ------------VPVFLLRLGE-ASWALVEGGELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
3bk1A           VEIIPLGGGEIGKNITVFRFR--DEIFVLDGGDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLP
2bg8A           ------SFEAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bfzA           --WVHTELGAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGI-KTLK
2bgaA           -------------NGLVLNTS--KGLVLVDSSLTKELIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
1bmiB           ------GWGMVPSNGMIVINN--HQAALLDTPINDAQVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQR
1bmiA           ------GWGMVPSNGMIVINN--HQAALLDTPINDAQVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYL-Q
2bg2A           WVHTELGSFAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bc2B           --WVHTELGAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADRIGGI-KTLK
1bvtA           ------NGEAVPSNGLVLNTS--KGLVLVDSSWDDELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
3bc2A           --WVHTELGAVPSNGLVLNTSK--GLVLVDSSLTKELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
2bg2B           -------------NGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bg7B           WVHTELGSEAVPSNGLVLNTS--KGLVLVDSSWDKELIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
1dd6B           ------GWGVVPKHGLVVLVN--AEAYLIDTPKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNS
2bg7A           -------------NGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bfkA           ----------VPSNGLVLNTSK--GLVLVDSSWDDKLTKELIEMFQKRVTDVIITHAHADCIGGIKTLKE
1dd6A           ------GWGVVPKHGLVVLVN--AEAYLIDTPFTAKDTVTWFVERGYKIKGSISSHFHSDSTGGIEWLNS
1a8tA           --AEIEGWGMVPSNGMIVINN--HQAALLDTPINDAQTEMLVNWLHAKVTTFIPNHWHGDCIGGLGYLQR
2bflA           --WVHTELGAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bflB           ------SFGAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2bfkB           ------SFEAVPSNGLVLNTSK--GLVLVDSSWDDELIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
1a7tA           ------GWGMVPSNGMIVINN--HQAALLDTPINDAQTEMLVNWLHAKVTTFIPNHWHGDCIGGLGYLQR
1a8tB           ------GWGMVPSNGMIVINN--HQAALLDTPINDAQTEMLVNWLHAKVTTFIPNHWHGDCIGGLGYLQR
1bc2A           --WVHTELGAVPSNGLVLNTS--KGLVLVDSSWTKELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
1dxkA           ------NGEAVPSNGLVLNTS--KGLVLVDSSWDDKLIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
1bmcA           ISISQLVHTELPSNGLVLNTS--KGLVLVDSSWTKELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKE
2az4B           --------DLPDDHIETLINNRLVPELKDLYDPRLGYEYHGAEDKDYQHTAVFLSHAHLDHSRMINYLDP
2bfzB           -------------NGLVLNTS--KGLVLVDSSLTKELIEMVEKKFQKRVTDVIITHAHADCIGGIKTLKE
2az4A           ------ELDLPDDHIETLINNRLVPELKDLYDPRLGYEYHGAEDKDYQHTAVFLSHAHLDHSRMINYLDP
3bv6A           ------GTGKKTQKNRLM--NTQHQMMRMGGVNLRTSIFPLDPFAIKEIDAVLASHDHADHIDVNVAAAV
1e5dA           ------SPMGTTYNAYLVED---EKTTLFDTVKAEYKGELLCGIDPKKIDYLVIQHLELDHAGALPALIE
2e7yB           -----MNIIGFSKALFSTWIYYSPERILFDAGEGVSTTLGS---KVYAFKYVFLTHGHVDHIAGLWGVVN
2br6A           ------KLLNLPVWCYLLETE--EGPILVDTGMPIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTN
3dabA           ----------------------------------------------------------------------
3bv6B           ------GTGKKTQKNRLMNTQ--HQMMRMGGVNLRTSIFPLDPFAIKEIDAVLASHDHADHIDVNVAAAV
3dhaA           ---------ESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKREPDDLLYIISSHLHFDHAGGNGAFTN
2d0oD           ------------------------------------------------APAIAIAV-IDGCDGLWREV--
2a7mA           ---------ESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKREPDDLLYIISSHLHFDHAGGNGAFTN
2bibA           --------YDFPDGSDSRYPWREGIETSYKHVLTDRVFRRLKELSVQKLDFILVTHTHSDHIGNVDELLS
2btnA           ------KLLNLPVWCYLL--ETEEGPILVDTGMPIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTN
2d0oB           --------------------------------------------------PAIAIAVIDGCDGLWREVLL
2dkfA           -RIVPFGAREVTGSAHLLLAG--GRRVLLDCGFQGKEEARNHAPDPKEVDAVLLTHAHLDHVGRLPKLFR
2d0pB           --------------------------------------------------PAIAIAVIDGCDGLWREV--
2d0pD           -----------------------------------------------SAPAIA-IAVIDGCDGLWREVLL
2cg2A           ----IYQVRGFDLNITFIRGD--SGWIVVDTLTTPATALVSRELGERPIRTVIYSHAHADHFGGVRGLVE
2e7yA           -----MNIIGFSKALFSTWIYYSPERILFDAGEGVSTTLGSKVY---AFKYVFLTHGHVDHIAGLWGVVN
2cg3A           ----IYQVRGFDLNITFIRGD--SGWIVVDTLTTPATALVSRELGERPIRTVIYSHAHADHFGGVRGLVE
2cfzA           ----IYQVRGFDLNITFIRGD--SGWIVVDTLTTPATARASRELGERPIRTVIYSHAHADHFGGVRGLVE
2cfuA           -------------NITFIRGD--SGWIVVDTLTTPATALVSRELGERPIRTVIYSHAHADHFGGVRGLVE
2a0wA           -------------------------------------------------------YTYEDYKNTAEWLLS


                         .         .         *         .         .         .         .:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
3bk2A           IFGKESPVPIYGARLTLGLLRGKLEEFGLR--PGAFNLKEISPDDRIQVGRYFTLDLFRTHSIPDNSGVV
2bg8B           RG-IKAHSTALTAELAKK------------NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVW
2cbnA           SRSMSGIIQPLTIYGPIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYEHPLECYGYRIEE
2bc2A           RGIKAHSTALTAELAKKNGYEE--------------PLGDLQTVTNLKFGNMVETFYPGKGHTEDNIVVW
3dh8A           RLNVQVLASERTCQAWKSESAVRVQRLPEACAWDALPVRAVADGEWLELGPRHRLQIEAHGHSDDHVVFY
3bk1A           IFGKESPVPIYGARLTLGLLRGKLEEFGLR--PGAFNLKEISPDDRIQVGRYFTLDLFRTHSIPDNSGVV
2bg8A           RG-IKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMVETFYPGKGHTEDNIVVW
2bfzA           ERGIKAHSTALTAELAKKNGY-------EEPLGDLQTVTNLKFGNMK-----VETFYPGKGHTEDNIVVW
2bgaA           R-GIKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMVETFYPGKGHTEDNIVVW
1bmiB           K-------------GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVW
1bmiA           RKGVQSYANQMTIDLAKEKGLPVPEH------------GFTDSLTVSLDGMPLQCYYLGGGHATDNIVVW
2bg2A           R-GIKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVW
2bc2B           ERGIKAHSTALTAELAKK-------NGYEEPLGDLQTVTNLKFG-----NMKVETFYPGKGHTEDNIVVW
1bvtA           RGIKAH-STALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVW
3bc2A           RGIKAHSTALTAELAKKN--------------GYEEPLGDLQTVTNLKFGNMKETFYPGKGHTEDNIVVW
2bg2B           R-GIKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKVEFYPGKGHTEDNIVVW
2bg7B           RGIKAH-------------STALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVW
1dd6B           RSIPTYASELTNELLKKDGKVQ--------------ATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVW
2bg7A           R-GIKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKVEFYPGKGHTEDNIVVW
2bfkA           R-GIKAHSTALTAELAKKNGY-------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVW
1dd6A           RSIPTYASELTNELLKKDGKVQ--------------ATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVW
1a8tA           K-GVQSYANQMTIDLAKEKGLPV-------------PEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVW
2bflA           RGIKAHSTA--------------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVW
2bflB           RG-IKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKETFYPGKGHTEDNIVVW
2bfkB           RGIKAHSTALTAELAKKN--------------GYEEPLGDLQTVTNLKFGNMVETFYPGKGHTEDNIVVW
1a7tA           K-GVQSYANQMTIDLAKE-------KGLPVPEHGFTDSLTVSLD-----GMPLQCYYLGGGHATDNIVVW
1a8tB           K-GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQC------------YYLGGGHATDNIVVW
1bc2A           RGIKAHSTALTAELAKKN--------------GYEEPLGDLQTVTNLKFGNMKVETYPGKGHTEDNIVVW
1dxkA           RGIKAHSTALTAELAKKN--------------GYEEPLGDLQTVTNLKFGNMKVEFYPGKGHTEDNIVVW
1bmcA           RGIKAHSTA--------------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYGKGHTEDNIVVW
2az4B           AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALL
2bfzB           R-GIKAHSTALTAELAKKNGYEE-------------PLGDLQTVTNLKFGNMKETFYPGKGHTEDNIVVW
2az4A           AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALL
3bv6A           LQNCGEHVKFIGPQACVDLWLGWG--------VPQERCIVAKVGDVLEIGDVKIRVLDSFDRTALVTLPK
1e5dA           ACQPEKIFTSSLGQKAMESHFHY----------KDWPVQVVKHGETLSLGKRTVTFYETRLHWPDSMVSW
2e7yB           IRNNEKPLDVFYPEGNRAVEEYTEFIANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTVSFGHIF
2br6A           TPIIVQRTEYEAALHRE-----------EYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHFIKT
3dabA           -IQINQVRPKLPLLKILHAAGA--------------QGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYC
3bv6B           LQNCGEHVKFIGPQACVDLWLGWG--------VPQERCIVAKVGDVLEIGDVKIRVLDSFDRTALVTLPK
3dhaA           TPIIVQRTEYEAALHRE-----------EYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLF
2d0oD           -------------------------LLGIEEEGIPFRLQHHPAGEVVDSAWQAARLLVGIACDRHMLVVN
2a7mA           TPIIVQRTE-----------YEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHFIET
2bibA           TYPVDRVYLKKYSDSRITNLYGYDKVLQTATETGVSVIQNIQGDAHFQFGDMDIQLYNYENETDSSGELK
2btnA           TPIIVQ-------RTEYEAALHREEYMKECI----LPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHFIKT
2d0oB           GIEEEG--------------------IPFRLQHHPAGEVVDSAWQAARSSPLLVGIACDRHMLVVHYK-N
2dkfA           EGYATRATVLLEIVLEDALKVDEPFFGPEDVEEALGHLRPLEYGEWLRLGALSL-AFGQAGHLPGSAFVV
2d0pB           -------------------------LLGIEEEGIPFRLQHHPAGEVVDSQAARSSPLLVGACDRHMLVVN
2d0pD           GIEEEGIPFRLQHHPA--------------------GEVVDSAWQAARSSPLLVGIACDRHMLVVHYK-N
2cg2A           PQQVASGAVQIIAPAGFMEAAIKENVLAGNAM--MRRATYQYGTQLPKGPQGQVDMAIGKGLARGPLSLL
2e7yA           IRNNGMGDREKPLDVFYPEGNRAVEEYANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTKHVSSE
2cg3A           PQQVQIIAPAGFEAAIVLAGNARRATYQYGTQLPKGPQGQVAIGKGLARGPLSLLAPTRLIEGEGEDLVL
2cfzA           PQQVASGAVQIIAPAGFMEAAIKENVLAGNAMMRRATYQYGTQLPKGPQGQVDMAI-GKGLARGPLSLLA
2cfuA           PQQVASGAVQIIAPAGFMEA-AIVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARGPLSLLAPTR
2a0wA           HTKHRPQKLTQAQIFDYSEIP--NFPRSTVPGHAG--RLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFP


                         +         .         .         .         .         *         .:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGE
3bk2A           IRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEEIAKELDRV---
2bg8B           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2cbnA           HDAPGALNAQALKAAGVPPGPLFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTGPCDAAL--
2bc2A           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
3dh8A           DVRRRRLFCGDALGAFDEAEGVWVFDDMEAYLESL-ERLQRLPTLLQLIPGHG-----------------
3bk1A           IRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNRPGYTPSEEIAKE---------
2bg8A           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bfzA           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bgaA           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1bmiB           LPTENILFGGCMLKDNQTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIV--
1bmiA           LPTENILFGGCMLKDNQASIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIV--
2bg2A           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bc2B           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1bvtA           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
3bc2A           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bg2B           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bg7B           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1dd6B           LPERKILFGGCFIKPY--GLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVK
2bg7A           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bfkA           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1dd6A           LPERKILFGGCFIKPY--GLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLT------
1a8tA           LPTENILFGGCMLKDNQTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIV--
2bflA           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bflB           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2bfkB           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1a7tA           LPTENILFGGCMLKDNQTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIV--
1a8tB           LPTENILFGGCMLKDNQTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIV--
1bc2A           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1dxkA           LPQYNILVGGSLVKSTSAKLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1bmcA           LPQYNILVGGCLVKSTSAKDLNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2az4B           IRT----PDHFITYTGDLRLHGHNREETLAFCEKAKHTELLMMEGVSIFPEREPDPAQIAVVSEEDL---
2bfzB           LPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
2az4A           IRTPD----HFITYTGDLRLHGHNREETLAFCEKAKHTELLMMEGVSISPEREPDPAQIAVV--------
3bv6A           GVSSYDKAILDGMDERASGGSVYHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKM---------
1e5dA           FADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFI--
2e7yB           EVRRKLKKEFQGLDSKEISRLVKEKGRDFVTEEYHKKVLTISGDSLALDPEEIRGCTFLDARDRRYKNHA
2br6A           EQSGSVLLTIDASYTKENFEDEFAGFDPELALSSIKRKEVVKKEKPIIFFGHDI-EQEKSCRVFPEYI--
3dabA           GGD----LLGELL-----GRQSFSVKDPSPLYDMLRKNLVTL----------------------------
3bv6B           GVSSYDKAILDGMDERAVGGSVYHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMT--------
3dhaA           EQSGSVLLTIDASYTKENFEDPFAGFDPELALSSIKRKEVVKKEKPIIFFGHDIEQEKSCRV--------
2d0oD           LPASAPLFTLMHHQDSQAHR--NTGNNAARLVKGIPFR--------------------------------
2a7mA           EQSGSVLLTIDASYTKENFEDPFAGFDPELALSSIKRKEVVKKEKPIIFFGHDIEQEKSCRV--------
2bibA           KIWDDNSNSLISVVKVNGKKIYLGGDLDNVHGAEDKYGPLIGKVDLMKFNHHHDTNKSNTKDFIKNL---
2btnA           EQSGSVLLTIDASYTKENFEDPFAGFDPELALSSIKRKEVVKKEKPIIFFGHDI-EQEKSCRVFPEYI--
2d0oB           LPASAPLFTLMHHQDSQAHR--NTGNNAARLVKGIPFR--------------------------------
2dkfA           GEGRTLVYSGDLGNTYGDRPHRPYRETVREFLEILEKTLSQGGK--VLIPTFAVERAQEILYVLYTH---
2d0pB           LPASAPLFTLMHHQDSQAHR--NTGNNAARLVKGIPFR--------------------------------
2d0pD           LPASAPLFTLMHHQDSQAHR--NTGNNAARLVKGIPFR--------------------------------
2cg2A           APTRLIEGEGEDLVLDGVPFTFQNTPGTESPAE-------------------------------------
2e7yA           VSFGY--HIFEVRRKLKKEFQGLDSKEISRLVKEKGRDFVTEEYHKKVLTISGDSL--------------
2cg3A           DGVPF-----------------------------------------------------------------
2cfzA           P---------------------------------------------------------------------
2cfuA           LIEGE-----------------------------------------------------------------
2a0wA           VRVFHLLGVDTLVVTNAAGNPKFEVGD-------------------------------------------


                         .         .         .         +         .         .         .:280
query           KI
3bk2A           --
2bg8B           --
2cbnA           --
2bc2A           --
3dh8A           --
3bk1A           --
2bg8A           --
2bfzA           --
2bgaA           --
1bmiB           --
1bmiA           --
2bg2A           --
2bc2B           --
1bvtA           --
3bc2A           --
2bg2B           --
2bg7B           --
1dd6B           GL
2bg7A           --
2bfkA           --
1dd6A           --
1a8tA           --
2bflA           --
2bflB           --
2bfkB           --
1a7tA           --
1a8tB           --
1bc2A           --
1dxkA           --
1bmcA           --
2az4B           --
2bfzB           --
2az4A           --
3bv6A           --
1e5dA           --
2e7yB           AI
2br6A           --
3dabA           --
3bv6B           --
3dhaA           --
2d0oD           --
2a7mA           --
2bibA           --
2btnA           --
2d0oB           --
2dkfA           --
2d0pB           --
2d0pD           --
2cg2A           --
2e7yA           --
2cg3A           --
2cfzA           --
2cfuA           --
2a0wA           --