[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58208.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eh7A.bssp"
#ERROR : Can't open dsspfile "3dlxB.bssp"
#ERROR : Can't open dsspfile "3dlxA.bssp"
#ERROR : Can't open dsspfile "1dfxA.bssp"
#ERROR : Can't open dsspfile "3dlxC.bssp"
#ERROR : Can't open dsspfile "3dlxD.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3cdkD.bssp"
#ERROR : Can't open dsspfile "3cdkB.bssp"
#ERROR : Can't open dsspfile "2ahuA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"

## Summary of PDB Search
:728
    5e-28  27%  3eh7A  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    2e-10  13%  3dlxB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    7e-09  18%  3dlxA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    7e-09  11%  1dfxA  [x.x.x] DESULFOFERRODOXIN
    1e-08  13%  3dlxC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    7e-08  18%  3dlxD  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    4e-07  16%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    5e-05  19%  3cdkD  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    6e-05  21%  3cdkB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    3e-04   6%  2ahuA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-04  10%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
:728

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3eh7A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3eh7A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxYSLSCNADLTPDLIPKMRGLEKSGKKIAILGQINPELPFMYGD
3eh7A           ----------------------------------------------AESAHLVIGEIN----RQPYVHGD
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ---------------------------------------------------EEIVDIGAFAPEDIHIPQI
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ---------------------------FEDEVYLDALVIAQAVHNNGGIVQVQKVKKATLHPKSVRIPGY
2ahvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AQVPSENFDAIVDHPQYAFKLFGPPNMAINPSDYMIGLHASALIKDGGTIQLGIGSLSDAVTYLIKMRHQ
3eh7A           NLIHISKLDYIVADYPIYSLAKPKIGEVEEAIGRNCA----ELIEDGATLQLGIGAIPDAALLFLKDKKD
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           Y------VHRLIKGEKYEKRI---ERLSIRKRERIIK-RAALEFEDGMYANLGIGIPLLASNFIS-----
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------RMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVH-
3cdkB           ----------------------------MKEARKRMVKRAVQEIKDGMNVNLGIGMPTLVANEIPDGVHV
2ahuA           LVDIVVVDPDQSQLYGGAPVNRFISGDFTLDLPLNLVARRALFERKGAVGNVGVGIADGIGLVAREEGCA
2ahvA           -------------------------------------------------------------TFVDPRQQG


                         .         *         .         .         .         .         +:350
query           YNAVYCALLSEANVLGKFEKMIHNVGGNEPFKEGLYATSEMFVDGFMQLYRSGILKRKVYPHETLQRLLN
3eh7A           LG--------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           MLQSE-----------------------------------------------------------------
2ahuA           DDILTVETGPIGGITSGANVNTRAILDTSQFDFYHGGGLDVCYLSFAEVDQHG-----------------
2ahvA           GKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRAT-TCDSEGYATFEDEVMYLDALVIAQA-VHNNG


                         .         .         .         .         *         .         .:420
query           ENKLSHQISPAALTRLIEEKIIHPQLSEKEVTLLQQWGIFKMELKYQNGFIYPPNEIPIPADLADSQSAE
3eh7A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           GIVMMQVQKMVKKATLHPKSVRIPGYLVDIVVVDPDQSQLYGGAPVNRFISGDFTLDPLNQRKLVARRAL


                         .         .         +         .         .         .         .:490
query           KIYRHCLEPHIKGGHLLHASFFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEELKRLQRKDARF
3eh7A           --------------HPGKVATFLGSEDVYHFID-----KNPDVELYPVDYVNDPR------VIAQNDNVS
3dlxB           -----------------------------------------------------FSSDESFAMIRGGHVLT
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ------------------------------------------TILPGASFFSSDESFAMIRGGHVD--LT
3dlxD           ---------------------------------------------------------------------T
2ahwD           ----------------------------------------------------------------------
3cdkD           --------------------------------------------------------SFAMIRGGHIDLAI
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           FEMRKGAVGNVGVGIADGIGLVAREEGCADDFILTVETGPIGGITANVNTRAILDMTSQFDFYHGGGLDV


                         *         .         .         .         .         +         .:560
query           LNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIHSNIIWNYGHT
3eh7A           INSCIEIDL-GQVVSECI-GSKQFSGTGGQVDYVRGAAWSKNGKSIAIPSTAKNGTASRIVPIIAEGAAV
3dlxB           MLGAMQVSKYGDLANWMIPG--KVKGMGGAMDLVSSA-----KTKVVVTMEHSAKGN--AHKIMEKCTLP
3dlxA           -LGAMQVSKYG-DLANWMIPGKMVKGMGGAMDLVSSA-----KTKVVVTMEHSAKGN--AHKIMEKCTLP
1dfxA           --------------------KCTHCGNIVEVLHGGGAELVCCGEPMKHMVEGSTDGAMHVPVIEKVDGGY
3dlxC           MLGAMQVSKYGDLANWMIPGKM-VKGMGGAMDLVSSA-----KTKVVVTMEHSAKGN--AHKIMEKCTLP
3dlxD           MLGAMQVSKYGDLANWMIPGKM-VKGMGGAMDLVSSAKTKV----VVTMEHSAKGN---AHKIMEKCTLP
2ahwD           -LSFAEVDQHGNVGVHKFNG--KIMGTGGFIDISATSK-----KIIFCGTLTKLNIVQIELPEITFSGKI
3cdkD           L-GGMEVSEQGDLANWMIPGM--VKGMGGAMDLVNGAK-----RIVVIMEHVNSK-------VKKTCSLP
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           YLSFAEVDQHGNVGVHKF--NGKIMGTGGFIDISATSK-----KIIFCGTLT--AGSL--KTEIADGKLN


                         .         .         .         *         .         .         .:630
query           TIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQDFLLREAQKAGKISKNYQIPDDxxxxxxxx
3eh7A           TTLRNEVDYVVTEYGIAQLKGKSLRQRAEALIAIAHPDFREELTKHLRKR--------------------
3dlxB           LTGKQCVNRIITEKAVFDVDKKKGLTLI----ELWEGLTVDDVQKSTGCDFAVSPKLMPMQQ--------
3dlxA           LTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTV----------------------------------
1dfxA           LIKVGSVPHPMEEWIELLADGRSYTK--------------------------------------------
3dlxC           LTGKQCVNRIITEKAVFDVDKKKGLTLI------------------------------------------
3dlxD           LTGKQCVNRIITEKAVFDVDKKKGIELWDDVQKSTGCDFAV-----------------------------
2ahwD           ALERGLDVRYITERAVFTLKEDLHPGVDLDFTPVISPELKL-----------------------------
3cdkD           LTGQKVVHRLITDLAVFDFVNGRMTLTELTIEEVYE----------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           IVQEGRVKKFIRELPEITFSGKIALERGLDVRYITE----------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3eh7A           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1dfxA           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
3dlxD           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
3cdkD           ----------------------------------------------------------------------
3cdkB           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
3eh7A           ----------------------------
3dlxB           ----------------------------
3dlxA           ----------------------------
1dfxA           ----------------------------
3dlxC           ----------------------------
3dlxD           ----------------------------
2ahwD           ----------------------------
3cdkD           ----------------------------
3cdkB           ----------------------------
2ahuA           ----------------------------
2ahvA           ----------------------------