[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d1tA.bssp"
#ERROR : Can't open dsspfile "3cw9A.bssp"
#ERROR : Can't open dsspfile "2d1sA.bssp"
#ERROR : Can't open dsspfile "2d1rA.bssp"
#ERROR : Can't open dsspfile "3dlpX.bssp"
#ERROR : Can't open dsspfile "1amuB.bssp"
#ERROR : Can't open dsspfile "3dhvA.bssp"
#ERROR : Can't open dsspfile "3e7wA.bssp"
#ERROR : Can't open dsspfile "2d1qA.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "3cw8X.bssp"
#ERROR : Can't open dsspfile "3c5eA.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "3dayA.bssp"
#ERROR : Can't open dsspfile "3b7wA.bssp"
#ERROR : Can't open dsspfile "3e53A.bssp"
#ERROR : Can't open dsspfile "2efjA.bssp"
#ERROR : Can't open dsspfile "2atwA.bssp"
#ERROR : Can't open dsspfile "2atwC.bssp"
#ERROR : Can't open dsspfile "3c30A.bssp"
#ERROR : Can't open dsspfile "2d42A.bssp"
#ERROR : Can't open dsspfile "3dmyA.bssp"
#ERROR : Can't open dsspfile "3cboA.bssp"
#ERROR : Can't open dsspfile "2c4iA.bssp"
#ERROR : Can't open dsspfile "3cbpA.bssp"
#ERROR : Can't open dsspfile "3cbmA.bssp"
#ERROR : Can't open dsspfile "3cq0A.bssp"
#ERROR : Can't open dsspfile "1dl3A.bssp"
#ERROR : Can't open dsspfile "2e0cA.bssp"
#ERROR : Can't open dsspfile "2e22A.bssp"
#ERROR : Can't open dsspfile "3e3cA.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"
#ERROR : Can't open dsspfile "2e12A.bssp"
#ERROR : Can't open dsspfile "2cwwA.bssp"
#ERROR : Can't open dsspfile "3bl4A.bssp"
#ERROR : Can't open dsspfile "2e1dB.bssp"
#ERROR : Can't open dsspfile "3dmyB.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "2ehpA.bssp"
#ERROR : Can't open dsspfile "2c24B.bssp"
#ERROR : Can't open dsspfile "3bbjB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2c24A.bssp"
#ERROR : Can't open dsspfile "2cwnA.bssp"
#ERROR : Can't open dsspfile "3bbjA.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "3cqcB.bssp"
#ERROR : Can't open dsspfile "3d5yA.bssp"
#ERROR : Can't open dsspfile "1aq2A.bssp"
#ERROR : Can't open dsspfile "3ci0K.bssp"
#ERROR : Can't open dsspfile "2bowA.bssp"
#ERROR : Can't open dsspfile "1aylA.bssp"

## Summary of PDB Search
:538
    4e-67  22%  2d1tA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    5e-67  22%  3cw9A  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    8e-66  21%  2d1sA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    1e-63  21%  2d1rA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    2e-63  21%  3dlpX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    3e-63  23%  1amuB  [e.23.1] GRAMICIDIN SYNTHETASE 1
    5e-62  19%  3dhvA  [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
    3e-61  21%  3e7wA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    2e-60  20%  2d1qA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    8e-60  20%  1ba3A  [x.x.x] LUCIFERASE
    6e-57  20%  3cw8X  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    8e-54  18%  3c5eA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    2e-53  24%  1amuA  [e.23.1] GRAMICIDIN SYNTHETASE 1
    7e-53  18%  3dayA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    6e-52  18%  3b7wA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    2e-42  17%  3e53A  [x.x.x] FATTY-ACID-COA LIGASE FADD28
    2e-33   9%  2efjA  [x.x.x] 3,7-DIMETHYLXANTHINE METHYLTRANSFERASE
    4e-29   7%  2atwA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    9e-29   7%  2atwC  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    3e-28   7%  3c30A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    1e-27  11%  2d42A  [x.x.x] NON-TOXIC CRYSTAL PROTEIN
    2e-24  15%  3dmyA  [x.x.x] PROTEIN FDRA
    2e-23   9%  3cboA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    1e-22  12%  2c4iA  [x.x.x] AVIDIN
    2e-21   9%  3cbpA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    8e-20  10%  3cbmA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    1e-18   8%  3cq0A  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    4e-18  11%  1dl3A  [c.1.2] PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
    5e-18  12%  2e0cA  [x.x.x] 409AA LONG HYPOTHETICAL NADP-DEPENDENT
    9e-18   6%  2e22A  [x.x.x] XANTHAN LYASE
    7e-16  12%  3e3cA  [x.x.x] L0044
    1e-14   7%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    3e-13  12%  2e12A  [x.x.x] HYPOTHETICAL PROTEIN XCC3642
    5e-13   9%  2cwwA  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    8e-13   6%  3bl4A  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-12   9%  2e1dB  [x.x.x] TRANSALDOLASE
    3e-12  15%  3dmyB  [x.x.x] PROTEIN FDRA
    2e-11   7%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    4e-11  15%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    5e-11  12%  2ehpA  [x.x.x] AQ_1627 PROTEIN
    5e-11  14%  2c24B  [x.x.x] ENDOGLUCANASE
    5e-11  15%  3bbjB  [x.x.x] PUTATIVE THIOESTERASE II
    1e-10   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    3e-10  17%  2c24A  [x.x.x] ENDOGLUCANASE
    4e-10   8%  2cwnA  [x.x.x] TRANSALDOLASE
    6e-08  15%  3bbjA  [x.x.x] PUTATIVE THIOESTERASE II
    1e-07   8%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-06  10%  3cqcB  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP133
    3e-05   9%  3d5yA  [x.x.x] INTRACELLULAR ARABINANASE
    8e-05  10%  1aq2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE
    8e-05  20%  3ci0K  [x.x.x] PSEUDOPILIN GSPK
    3e-04   8%  2bowA  [d.60.1] MULTIDRUG-EFFLUX TRANSPORTER 1 REGULATOR BMRR
    4e-04   9%  1aylA  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE
:538

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVXXXXXXXXXXXXXXXXXVAIYLPKRP
2d1tA           ----------AGTQLRKYMERYAKLGAIAFTGVDYSYAEYLEKSCLGKALQNYGLVVDGR-IALCSENCE
3cw9A           ----------VNEMLRRAATRAPDHCALAVPARGLRLAELRARVEAVAARLHADGLRPQQRVAVVAPNSA
2d1sA           ----------AGTQLRKYMERYAKLGAIAFTGVDYSYAEYLEKSCLGKALQNYGLVVDGR-IALCSENCE
2d1rA           ----------AGTQLRKYMERYAKLGAIANAVTGVDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCE
3dlpX           ----------VNEMLRRAATRAPDHCALAVPARGLRLAELRARVEAVAARLHADGLRPQQRVAVVAPNSA
1amuB           ----------IHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
3dhvA           ----------LLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQP
3e7wA           ----------LLHAIQTHAETYPQTDAFRSQGQSLTYQELWEQSDRAAAAIQKRISGEKKSILVYGHMEP
2d1qA           ----------AGTQLRKYMERYAKLGAIANAVTGVDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCE
1ba3A           ---------------MKRYALVPGTIAFTDAEVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSL
3cw8X           ----------VNEMLRRAATRAPDHCALAVPARGLRLAELRARVEAVAARLHADGLRPQQRVAVVAPNSA
3c5eA           -----ASDVLDHWADMEKAGKRPPSPALWWVNLMWNFRELSENSQQAANVLSGACGLQRGDVAVVLPRVP
1amuA           ----YPRDKTIHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
3dayA           -----ASDVLDHWADMEKAGKRPPSPALWWVNLMWNFRELSENSQQAANVLSGACGLQRGDVAVVLPRVP
3b7wA           -------DVLDHWADMEKAGKRPPSPALWWVNLMWNFRELSENSQQAANVLSGACGLQRGDVAVVLPRVP
3e53A           ----------LPAALRACARLQPHDPAFTFDYITLTWSQLYRRTLNVAQELSRCGSTGDR-VVISAPQGL
2efjA           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ----------------------------------------------------------------------
3dmyA           ----------------------RNAIAPVSSGFICGLYTGGTLAAEAAGLLAGHLGVET--HQHGLDADS
3cboA           ----------------------------------------------------------------------
2c4iA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cq0A           ----------LVEFGTQILKVVPGRVSTEVDALSFDKKATVKKALHIIKLYKDAGVPKER-VLIKIASTW
1dl3A           MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVER-------VGVFVNEEP
2e0cA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
2e12A           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           ---------FVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDR-ILIKLSSTW
3dmyB           --------------------------------------------------------------QHGLDADS
1b8aA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
2ehpA           -------------THEGKVEGVPGNYPLTAGLALCTLWILDKEIEEPTLSIPETNFVTLALGSVNVGKGG
2c24B           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2c24A           ----------------------------------------------------------------------
2cwnA           -----------------------RVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDR-ILIKLSSTW
3bbjA           ----------------------------------------------------------------------
2ao0A           -----------------------------------ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYAL
3cqcB           ----------KALDLLEYIDININDLKLEILCKALQRDNWVSKDSIF--------------VKILLPEVK
3d5yA           ----------------------------------------------------------------------
1aq2A           -----------DNIVKPVSKAGHATKVIFLTFGVLPPVSRLTADQTQYHFLSGFTAKLAGTITEPTP---
3ci0K           ----------------------------------------------------------------------
2bowA           --YFLNLQKLIKYIADRQLTVVSDVYELIIPIHYRVEM--------------------------------
1aylA           -----------------------------HATKVIFLTADAFGVLPPVSRLTADQTQYHFLSGFTAKLAP


                         .         .         *         .         .         .         .:140
query           ETVVTLFXXXXXXXVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
2d1tA           EFFIPVIAGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKKGLDKVITVQKTVTTIKTIVILDSKV
3cw9A           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARI---------
2d1sA           EFFIPVIAGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKKGLDKVITVQKTVTTIKTIVILDSKV
2d1rA           EFFIPVIAGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKKGLDKVITVQKTVTTIKTIVILDSKV
3dlpX           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARI---------
1amuB           DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNQFNGQVEI----------
3dhvA           EMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHK-
3e7wA           HMIVSFLGSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAGLSIDAVGQQIQTVSAEELLENEGGS
2d1qA           EFFIPVIAGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKKGLDKVITVQKTVTTIKTIVILDSKV
1ba3A           QFFMPVLGALFIGVAVAPANDIYNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKT
3cw8X           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVI-----AVGRQVADAIFQSGSGARIIFLG
3c5eA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKS
1amuA           DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNI-----------------
3dayA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKS
3b7wA           EWWLVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKS
3e53A           EYVVAFLGALQAGRIAVPLSVPQRSDSVLSDSSPVAILTTSSAVDDVVQHVPPSIIEVDLLDLDAPEY--
2efjA           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ----------------------------------------------------------------------
3dmyA           HQIIDLGDDFYTVGRPHPIDPTLRNQLIADLGAKPQVRVLLLDVVIGFGATADPAASLV-----------
3cboA           ----------------------------------------------------------------------
2c4iA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cq0A           EGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMDFYKALDYTAETDPGVLSVKKIY
1dl3A           EKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILL----------
2e0cA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
2e12A           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           EGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYDPGVKSVTKIY
3dmyB           HQIIDLGDDFYTVGRPHPIDPTLRNQLIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARL
1b8aA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
2ehpA           DIKLFLQKGEIYVLEFQPLSETD-IKKLESILFGRAPIPKKTGE--------------------------
2c24B           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1e3aB           -------------------------------------------------------------SNMWVIGKS
2c24A           ----------------------------------------------------------------------
2cwnA           EGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQGDPGVKSV
3bbjA           ----------------------------------------------------------------------
2ao0A           TVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYL
3cqcB           DLLQADEFVLKANYEYYVQGQI------------------------------------------------
3d5yA           ----------------------------------------------------------------------
1aq2A           -TFSACFGA-----AFLSLHPTQYAEVLVKRMQAAGAQAYLVN---------------------------
3ci0K           ----------------------------------------------------------------------
2bowA           ----------------------------------------------------------------------
1aylA           TPTFSACFGAA----FLSLHPTQYAEVLVKRMQAAGAQAYLVNTKRISIIDAILNGSLDNAETFTL----


                         +         .         .         .         .         *         .:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
2d1tA           DYRGYQCLDTFIKRNTPPGYQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDGN
3cw9A           -------IFLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQV
2d1sA           DYRGYQCLDTFIKRNTPPGFQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPN
2d1rA           DYRGYQCLDTFIKRNTPPGFQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIFSHARDPIYGN
3dlpX           -------IFLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQV
1amuB           -------------FEEDTIKIREGTNLHVPSKSTDLAYVIYT-----NPKGTMLEHKGISNLKVFFENSL
3dhvA           --------------------------GNTPNPEHAVKGDENFYIIYTSPKGVQITYNCLVSFTKWAVEDF
3e7wA           VSQD------------------------QWVKEHETFYIIYTSGSTGNPKGVQISAANLQSFTDWICADF
2d1qA           DYRGYQCLDTFIKRNTPPG----FQASSFKTVEVDRKEQVALIMNSSLPKGVQLTHENIFSHARDPIYGN
1ba3A           D--YQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSTGLPKGVALPHRTACVRFSHARDGN
3cw8X           DLVRDGEPYSYGPPIEDPQRE-----------PAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQV
3c5eA           C--------DGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
1amuA           ----QFNGQVEIFEEDTIKIREGTNLHVPSKST-DLAYVIYTS-----PKGTMLEHKGISNLKVFFENSL
3dayA           CDG--------WLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
3b7wA           --------CDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT
3e53A           ---------------------------------PSTAYLQYTPAGVVSHQNVRVNFEQLSGYFADGIPP-
2efjA           --------------------------------------------------------------------YA
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ---------------------------------------------------------NLLRELEIYGMQY
3dmyA           --------------------SAWQKACAARLDNQPLYAIATVTGTERDPQCRSQQIATLEDAGIAVVSSL
3cboA           ----------------------------------------------------------------------
2c4iA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cq0A           SYYKRHGYATEVMAASFRNLDELKAGIDNMTLPLNLLEQLYESTDPIENKLNSESAKEEGVEKVSFINDE
1dl3A           --------DTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVR----PFAVDVSSGVEAFGKKDHDSIK
2e0cA           ----------------------------------------------------------------------
2e22A           ----------------------------SDNVNAVYERRTMALAATTVGSSLYGNADLKEDILDALDWLY
3e3cA           --------------------------RGSMIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQ
2asbA           ----------------------------------------------------------------------
2e12A           APHVYTEQAQIATLEHWVKLLDGQ--ERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHL
2cwwA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           NYYKKFGYKTIVMGARNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQTSDSEK-------
3dmyB           DN-------------------------------QPLYAIATVTGTERDPQCRSQQIATLEDAGIAVVSSL
1b8aA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1e3aB           KA----QDAKAIMVNGPQ-FGWYAPAYTYGIGLHGAGYDVTGNTPFAYP-GLVFGHNGVISWGSTAGFG-
2c24A           ----------------------------------------------------------------------
2cwnA           TKIYNYYKKFGYKTIVMGASFRNLAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQT------------
3bbjA           ----------------------------------------------------------------------
2ao0A           DLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFLSVASVRPAVLQV
3cqcB           ----------------------------------------------------------------------
3d5yA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3ci0K           ----------------------------------------------------------------------
2bowA           ----------------------------------------------------------------------
1aylA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
2d1tA           QVSPGTAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTNVILVPTLFAILNKEL
3cw9A           GLRRHNVVLGLMPLYHVVGFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAA
2d1sA           QVSPGTAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNSEL
2d1rA           QVSPGTAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFILNKSEL
3dlpX           GLGRHNVVLGLMPLYHVVGFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAA
1amuB           NVTEKDRIGQFASISFDASVWEMFMALLTGASLYIILKDTINDFEQYINQKEITVITLPPTYVVHLDPER
3dhvA           NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARLFASLEQSDIQVWTSTPSFAEMCLMEA
3e7wA           PVSGGKIFLNQAPFSFDLSVMDLYPCLQSGGTLHCDAVNKPKVLFEELKKSGLNVWTSTPSFVQMCLMDP
2d1qA           QVSPGTAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSE
1ba3A           QIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFAKSTL
3cw8X           GLRRHNVVLGLMPLYHVVGFAVLVAALALDGTYVVIEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAA
3c5eA           GLQASDIMWTISDTGXXXXXXXXXXXXXXXXXXXXLPKFDPLVILKXXXXXXXXXXXXXXXXXXXXXXXD
1amuA           NVTEKDRIGQFASISFDASVWEMFMALLTGASLYIILINDFVKFEQYINQKEITVITLPPTYVVHL----
3dayA           GLQASDIMWTISDTGXXXXXXXXXXXXXXXXXXXXLPKFDPLVILKXXXXXXXXXXXXXXXXXXXXXXXD
3b7wA           GLQASDIMWTISDTGXXXXXXXXXXXXXXXXXXXXLPKFDPLVILKXXXXXXXXXXXXXXXXXXXXXXXD
3e53A           ---PNSALVSWLPFYHDGLVIGICAPILGGYPALTSPVSFLQRPARWHLASDFHAFSAAPNFAFELAARR
2efjA           KNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGC-------ASGPNTFSTVRDIVQSID---
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ANSHQYTYGSSYSDDTNPIRIAGLDAR------IPDPIVTDPVNHIVLDRRIITNTTSNSLEGVFSFSNA
3dmyA           PEATLLAAALIHPLSHTPSLLENVAVINIGLRSFALEL--QSASKPVVHYQWSPVAGGNKKLARLLE---
3cboA           --------------------------------------------------HGVCWIPDGGSLVGEVNED-
2c4iA           ------------TFGFTVNFSESTTVFTRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFRLKCSLTG
3cbpA           -----------------------------------------------------WIYYPDGGSLVGE--VN
3cbmA           --------------------------------------------------HGVCWIYYPDGGSLVGEVNE
3cq0A           PHNEDQMATEKLSDGIR-----------------------------------------------------
1dl3A           MFIKNAK---------------------------------------------------------------
2e0cA           ----------------------------------------------------------------------
2e22A           VNSYNSTRSRSAYNWWHWQGIPMSLNDIAVLLYDDISAARMATYMDTIDYFTPSIGLTGANRAWQAIVVG
3e3cA           GVLSEDEDIILHVHRYNYEIPSVLNIEQDYQLVIPKKVLSNNLTLHCHVRGNEKLFVDVYAKFIEP----
2asbA           ----------------------------------------------------------------------
2e12A           DASQEPQWIWMDRI--------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           ----------------------------------------------------------------------
3dmyB           PEAT-LLAAALIHPLHTPSLLENVAVINIG----------------------------------------
1b8aA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1e3aB           -DDVDIFAERLSAEKPGYYLHNKWVKMLSREETITVKNGQAETFTVWRTVHGNILQTDQTTQTAYAKRAW
2c24A           ----------------------------------------------------------------------
2cwnA           ----------------------------------------------------------------------
3bbjA           ---------------------------------------------------------AIPPQH-QCRRVD
2ao0A           ECHPYLAQNELIAHCQARGYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRS-PAQILLRWQVQRKVI
3cqcB           ----------------------------------------------------------------------
3d5yA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3ci0K           ----------------------------------------------------------------------
2bowA           ----------------------------------------------------------------------
1aylA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
2d1tA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEG-DDKPGASGKVVPLF
3cw9A           GSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGE-KVNIYGTTEAMNSLYMRQPK-TGTEMAPGFFSEVR
2d1sA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEG-DDKPGASGKVVPLF
2d1rA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDD-KPGASGKVVPLF
3dlpX           GSSLKLDSLRHVTFAGATMPDAVLETVHQHLPG-EKVNIYGTTEAMNSLYMRQPK-TGTEMAPGFFSEVR
1amuB           ILS-----IQTLITAGSATSPSLVNKWKEKVTYINAY-GPTETTICATTWVATKETIGHSVPIGAPIQNT
3dhvA           FSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVVTGIHVTLDQYKSLPVGYCKSDC
3e7wA           FSQDLLPHADTFMFCGEVLPVSVAKALLERFPKAKIFNTYGPTAVTSVEITNDVISRSESLPVGFAKPDM
2d1qA           LNKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEG-DDKPGASGKVVPLF
1ba3A           IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFE
3cw8X           GSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGE-KVNIYGTTEAMNSLYMRQPK-TGTEMAPGFFSEVR
3c5eA           LSSYKFPHLQNCVTVGESLLPETLENWRAQTGLD-IRESYGQTETGLTCMVSKTMKIKPG-YMGTAASCY
1amuA           -DPERILSIQTLITAGSATSPSLVNKWKEKVTYINAYGPTE-TTICATTWVATKETIGHSVPIGAPIQNT
3dayA           LSSYKFPHLQNCVTVGESLLPETLENWRAQTGLD-IRESYGQTETGLTCMVSKTM-KIKPGYMGTAASCY
3b7wA           LSSYKFPHLQNCVTVGESLLPETLENWRAQTGLD-IRESYGQTETGLTCMVSKTM-KIKPGYMGTAASCY
3e53A           TTDDDAGNILTILSGSERVQAATIKRFADRFAERVIRPSYGLAEATVYVATSKKPCAGATSLISYLPRSP
2efjA           KVPTIQIFLNDLFQNDFNSVFKLLPSFYR-NLEKENGRKIGSCLIAMPGSFYSRLFPEESMHFLHSCYCL
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
3c30A           -------------------------------------------------------------------SSL
2d42A           YTSRTSSQTRDTAGTNITGKYFANLFFEQVGLSGRIAFEGAVTNENKYTLDATQD-FRDSQTIRVPPFHR
3dmyA           ----------------------------------------------------------------------
3cboA           ---GEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPKSTSSCISTNALLPDPY
2c4iA           KWTNDLGSNMTIVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTIGSTTVFTGQCFIDRNGKEVLKTMW
3cbpA           EDGEMTGEKIAYVYPDERTALYGKFIDGE-MIEGKLATLMSTEEGRPFELMPGNSTSSCISTNALLPDPY
3cbmA           DGEMTGEKIAYVYPDERTALYGK--FIDGEMIEGKLATLMSTEEGRPFELMPGNSVYSCISTNALLPDPY
3cq0A           ----------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
2e0cA           -------------------------------------LYKEPEDGKIKFDKGKWIVPNKPDGIGPEITNA
2e22A           VRAVIVKLAAARNGLSGTGIFPYATGGDGFYADGSFVQHTTFAYTGGGSSVLETTANLMYLLSGSTWS-V
3e3cA           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
2e12A           ----------------------------------------------------------------------
2cwwA           ------------------------------------------------------RIQVNA-KGAARLLSR
3bl4A           -----------------------------------------------------------GTEAGLTLGDG
2e1dB           ----------------------------------------------------------------------
3dmyB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2cwwB           -------------------------------------------------------------KGAARLLSR
2ehpA           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3bbjB           --------LARVDVDFSPDSYAALARERT--VTTPELCGYVDLSARDGGSAKDPL-AFLPLAVDALPPIV
1e3aB           DGKEVASLLAWTHQMKAKNWQEWTQQAAKNWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWK
2c24A           ----------------------------------------------------------------------
2cwnA           ----------------------------------------------------------------------
3bbjA           PRQSHDGFLARVDVDFSPDSYAALARERT--VTTPELCGYVDLSARDGGSAKDPL-AFLPLAVDALPPIV
2ao0A           CIPKSSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVLTVDGKRVPRDAGHPL----------------
3cqcB           ----------------------------------------------------------------------
3d5yA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3ci0K           ----------------------------------------------------------------------
2bowA           ----------------------------------------------------------------------
1aylA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EIQVAREDGSLCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED
2d1tA           KAKVIDLDTKKSLPNRRGEVCVKGPMLMKGYVNNPEATKELIDE-----------EGWLHTGDIGYYDEE
3cw9A           IVRIGGGVDEIVANGEEGELIVASDSAFVGYLNQPQATAEKLQDGWY------------RTSDVAVWTPE
2d1sA           KAKVIDLDTKKSLGNRRGEVCVKGPMLMKGYVNNPEATKELIDEEG-----------WLHTGDIGYYDEE
2d1rA           KAKVIDLDTKKSLGNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWL-----------HTGDIGYYDEE
3dlpX           IVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDGWY-----------RTSDVAVWTPE
1amuB           QIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFVP-----GEKLYKTGDQARWLSD
3dhvA           RLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERA---------YKTGDAGYVEN
3e7wA           NIFIMDEEGQPLPEGEKGEIVIAGPSVSRGYLGEPELTEKAFFSHEGQWA---------YRTGDAGFIQD
2d1qA           KAKVIDLDTKKSLGNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWL-----------HTGDIGYYDEE
1ba3A           AKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDG-----------WLHSGDIAYWDED
3cw8X           IVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPEATAEK-----------LQDGWYRTSDVAVWTPE
3c5eA           DVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAA-------NIRGDFWLLGDRGIKDED
1amuA           QIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNP-----FVPGEKLYKTGDQARWLSD
3dayA           DVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDFW-------LLGDRGIKDED
3b7wA           DVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDFW-------LLGDRGIKDED
3e53A           IVRIVDSDTCIECPGTVGEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDG
2efjA           HWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEEGRMLLTFICKEDEFDLLEMSI
2atwA           ------REGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESYENRLRCYVVGVTRGAR
2atwC           --EFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGYEHGNRLRCYVVGVTRGAR
3c30A           IQSLFDFRLAALRIHQDSTA--KNASLINALVSRDSSRLDEFFSSVDELELSNAPDLRFISSHDNILWDD
2d42A           ATGVYTLEQGAFEKMTVLECVVSGNGIIRYYRTLPDNSYTEIVQRVVLQANGTPGFTISKEQNRAYFTGE
3dmyA           ----------------------------------------------------------------------
3cboA           ESERVYVAESLISSAGEFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG----NTLSLDEETVIDVPE
2c4iA           LLRSSNDIGDDWKATRVGINISARKCSLTGKWTNDLGSNMTI-----------------GAVNSRGEFTG
3cbpA           ESERVYVAESLISSAGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTL-----SLDEETVIDVP
3cbmA           ESERVYVAESLISSAGEGLFSKVGPNTVMSFYNGVRITHQEVDSRDWALNG----NTLSLDEETVIDVPE
3cq0A           ----------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
2e0cA           AIKVINKAVERAYGSSWLEVYAGEKAEKLVNDRFPKETQEMLLKY--------------RVVLKGPLE-S
2e22A           SDPNQSNVW-QWIYEAYRPLLYKGAMISRSYAQDHAVGHGIVA---------------------------
3e3cA           ----------------------------------------------------------------------
2asbA           ------REGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPESYEHGNRLRYVVGVTRGAR
2e12A           ----------------------------------------------------------------------
2cwwA           HLWVFRRDVVGPETPGLYPVYWGRRFLALALYNPHTDLAVRAYRFAPAEDPVALENLAQADPEGGYRLVH
3bl4A           ILRLTWPRGAAITAAERALRVGDDRHPLVDATTAD--VSRGA-----------------RAVFGRPCQAS
2e1dB           ----------------------------------------------------------------------
3dmyB           ----------------------------------------------------------------------
1b8aA           -----------------------------------------------------------------HYSSE
2cwwB           HLWVFRRDVVSGPETPGLYPVYWRRFLALALYNPHTDLAVRAYRFA------------------------
2ehpA           ----------------------------------------------------------------------
2c24B           -------------GSGMGELETIGDTLPVDYNGLPTLRLNVQTTVGWWISLLTLR--GWNTHDLSQYVEN
3bbjB           SLLVDWSWAPTV---ELTWHLRAIP--EPGPLAFRSTCALVSDGW--------------FDENVDLWDAR
1e3aB           GLL----------PFEMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLT
2c24A           --------KDSPVGSGMGELETIGDTTTVTYNGLPTLRLNVQTTVGWWISLLTLR--GWNTHDLSQYVEN
2cwnA           ----------------------------------------------------------------------
3bbjA           SLLVDWSWAPTV------ELTWHLRAIPEPGPLAFRSTCALVSDGWFD-------------ENVDLWDAR
2ao0A           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3d5yA           -----------------------PFGGVNFYEMDWSLKGDLWAHDPHTGSGIQ----IKTSEDGVHWENM
1aq2A           ----------------------------------------------------------------------
3ci0K           ----------------------------------------------------------------------
2bowA           ----------------------------------------------------------------------
1aylA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQXXXXXXXXXXXXXHPKLGQGIVAIVKPNKDNFDPEDLLA
2d1tA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVESGKNMTEKEVMDY
3cw9A           GTVRILGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTVVPRLGETLSADALDTF
2d1sA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNEKEVMDY
2d1rA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGNMTEKEVMD
3dlpX           GTVRILGRVPDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVRLGETLSADALDTF
1amuB           GNIEYLGRIDNQVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQL-RQ
3dhvA           GLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFLTSAIKK
3e7wA           GQIFCQGRLDFQIKLHGYRMELEEIEFHVRQSQYVRSAVVIPYQPNGTVEYLIAAIVPEEHFQLTSAIKK
2d1qA           KHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLSGKNMTEKEVMD
1ba3A           EHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEPAAVVVLEHGKTMTEKEIVD
3cw8X           GTVRILGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQWGQSVTACVPRLGETLSADALDTF
3c5eA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQEQLTKELQQ
1amuA           GNIEYLGRIDNQVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKH-IPLEQLRQ
3dayA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDRGEVVKAFVVLASQFLSHDPEQLQQ
3b7wA           GYFQFMGRADDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQEQLTKELQQ
3e53A           K--FIIG---------------------------------------------------------------
2efjA           NDLVIEGHKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPAGFSISPVSCDEHAASVVRSIYEP
2atwA           EPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSN-VAGLNAKGACIGPMGQRVR
2atwC           EPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIG-PMGQRVR
3c30A           GNASFYGIAQQELNKLIRRVAISGNWHLVQTPSEGKSVHILRRSSLIEATGQVVGYLYVGIVLNDNFALL
2d42A           GTISGQIGLQTFIDVVIEPLPG------------------------------------------------
3dmyA           ----------------------------------------------------------------------
3cboA           PYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYEAPEWYQVELKA
2c4iA           TYITAVTATSNEIKESPLHGTQNTINKRTQ----------------------------------------
3cbpA           EPYNHVSKYCASLGHKANHFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELVAYGYDHEAEWYQVELKA
3cbmA           PYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPEAPEWY--
3cq0A           ----------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
2e0cA           VNVAIRLMLDLYANIRPVKYIE-GLESPLKH--PEKVDMIIFRENTDDLYRGIEYPFNSEEKKIRDFLRK
2e22A           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
2asbA           EPLITLSRTHPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRN
2e12A           ----------------------------------------------------------------------
2cwwA           AEGDLLPGLVVDYY--------------------------------------------------------
3bl4A           RIALLGSSPVDRVFFLGINAVPCPTKFFTSE---------------------------------------
2e1dB           ----------------------------------------------------------------------
3dmyB           ----------------------------------------------------------------------
1b8aA           ITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVAVEGVVNF
2cwwB           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2c24B           GYLEFDGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCL-
3bbjB           GRLVAQSRQLARV---------------------------------------------------------
1e3aB           ADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGPGSAILNVWLTS
2c24A           GYLEFDIKGDFVIGFRDKVYERVYGLEIDVT-------------TVISNYVTVTTDWQHLRDFDPSSV--
2cwnA           ----------------------------------------------------------------------
3bbjA           GRLVAQSRQLARVG--------------------------------------------------------
2ao0A           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3d5yA           GWVFPSLPDWYKQYVPEKDEDHLWAPDICFY-------------NGIYYLYYSVSTFGKNTSVIGLATNQ
1aq2A           ----------------------------------------------------------------------
3ci0K           ---------------------------------------------------------------KRVHLEQ
2bowA           ----------------------------------------------------------------------
1aylA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKEQTAP
2d1tA           VASQVSNAKRLRGGVRFVDEVPKGLTGKIDGRAIREILK---------
3cw9A           CRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQV----------
2d1sA           VASQVSNAKRLRGGVRFVDEVPKGLTGKIDGRAIREILK---------
2d1rA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAIREILK---------
3dlpX           CRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQVS---------
1amuB           FSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQLEPDLTF--------
3dhvA           ELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVT---------
3e7wA           ELAASLPAYMIPRKFIYQDHIQMTANGKIDRKRIGEEVLVRSHHH---
2d1qA           YVASQVSNARLRGGVRFVDEVPKGLTGKIDGRAIREILK---------
1ba3A           YVASQVTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI---------
3cw8X           CRSSELADFKRPKRYFILDQLPKNALNKVLRRQL--------------
3c5eA           HVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRAKLRDKEW---------
1amuA           FSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQLEPDLTF--------
3dayA           HVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRAKLDKEWK---------
3b7wA           HVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRAKLRDKE----------
3e53A           ------------------------------------------------
2efjA           ILASHFGEAILPDLSHRIAKNAAK---VLRSGKG--------------
2atwA           NVMSELSGEKIDIIDYDDDPARFVANALSPAKVVSV------------
2atwC           NVMSELSGEKIDIIDYDDDPARFVANALSPAKVVSVSV----------
3c30A           ENIRSGSNSENLVLAVDTTPLVSTLKGNEPYSLDYVVHSAKDDSFIVG
2d42A           ------------------------------------------------
3dmyA           ------------------------------------------------
3cboA           FQATQ-------------------------------------------
2c4iA           ------------------------------------------------
3cbpA           FQA---------------------------------------------
3cbmA           --QVELKAFQ--------------------------------------
3cq0A           ------------------------------------------------
1dl3A           ------------------------------------------------
2e0cA           ELKVEIEDDTGIGIKVMSKYKTQRITRLAIQYAI--------------
2e22A           ------------------------------------------------
3e3cA           ------------------------------------------------
2asbA           VMSELSGEKIDIIDYDDDPARFVANALSPA------------------
2e12A           ------------------------------------------------
2cwwA           ------------------------------------------------
3bl4A           ------------------------------------------------
2e1dB           ------------------------------------------------
3dmyB           ------------------------------------------------
1b8aA           TPKAKLGFEILPEKIVVLNRAETPLPLDPTG-----------------
2cwwB           ------------------------------------------------
2ehpA           ------------------------------------------------
2c24B           ---VFSKRYADPFTVWFSD-IKITSE----------------------
3bbjB           ------------------------------------------------
1e3aB           MLKRTVVAAVPMPFDKWYSASGYETTQDGPTGSL--------------
2c24A           TCLVFSKRYADPFTVWFSD-IKITSE----------------------
2cwnA           ------------------------------------------------
3bbjA           ------------------------------------------------
2ao0A           ------------------------------------------------
3cqcB           ------------------------------------------------
3d5yA           TLDPRDPDYEWKDMGPVIHSTASDNYNAID------------------
1aq2A           ------------------------------------------------
3ci0K           PWASGPRFFPLPQGQIAV--TLRDAQACFNLNALAQ------------
2bowA           ------------------------------------------------
1aylA           ------------------------------------------------