[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58511.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1biaA.bssp"

## Summary of PDB Search
:111
    9e-04  17%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
:111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1biaA           ------TVPLKLIALLANGESGEQLGETLGMSRAAINKHIQT----------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1biaA           -----------------------------------------