[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58609.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dgqA.bssp"
#ERROR : Can't open dsspfile "3bn3A.bssp"
#ERROR : Can't open dsspfile "3c0nB.bssp"

## Summary of PDB Search
:238
    2e-06  10%  1dgqA  [c.62.1] LEUKOCYTE FUNCTION ASSOCIATED ANTIGEN-1
    1e-05   9%  3bn3A  [x.x.x] INTEGRIN ALPHA-L
    1e-04   8%  3c0nB  [x.x.x] AEROLYSIN
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRHGRLIFAMDATASREPTWDRACHIQAQMFQETAS
1dgqA           ----------------------------------KGNVDLVFLFDGSMSQPDEFQKILDFMKDVMKKLSN
3bn3A           ---------------------------------------LVFLFDGSMSQPDEFQKILDFMKDVMKKLSN
3c0nB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQHTQNETRKQKVNALVFVGDC
1dgqA           TSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTNTFGAINYVELGARPDATKVLIIITDG
3bn3A           TSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTNTFGAINYREELGARPDATKVLIIITD
3c0nB           ---------------------------------------ETELSIEIAANQSW-ASQNGGSTTTSLSQSV


                         +         .         .         .         .         *         .:210
query           MEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQIAQLTQGAYCRFDAASAAQLRDLLNAVxxxx
1dgqA           EAT-DSGNIDAAKDIIRYIIGIGKH--FQTKESQETLHKFASKP-ASEFVKILDTFEKLKDLFTEL----
3bn3A           GEATDSGNIDAAKDIIRYIIGIGKH--SQTKESQETLHKFASKPASEF-VKILDTGEKLKDLFTEL----
3c0nB           RPTVPARSKIPVKIELYKADISYPYEFKAD-VSYDLTLSGFLRWGGNAWYTPDNRPNWNHTFV-------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dgqA           ----------------------------
3bn3A           ----------------------------
3c0nB           ----------------------------