[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58618.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bvoA.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "3bx2B.bssp"

## Summary of PDB Search
:690
    9e-37  16%  1bvoA  [b.2.5] TRANSCRIPTION FACTOR GAMBIF1
    2e-14  13%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    2e-04  18%  3bx2B  [x.x.x] PROTEIN PUF4
:690

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bvoA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3bx2B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bvoA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3bx2B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bvoA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3bx2B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bvoA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3bx2B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWWLGKRQKAEVAPTPPMAAPSETPELSWED
1bvoA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------FKLMNIALGVSSSEVSRVEADSAWFGSWLD
3bx2B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPPVDPIGLEVGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT
1bvoA           ----------------------------------------------------------------------
1ei5A           DETGLVLSLEDAGHGRMKARFGTSPEMMDVVSANEARSARRDGETIELVRASENLRLSKGEAKHDIIG-R
3bx2B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGTVIATHLSQIL
1bvoA           TEQPHPKALRFRYECEGRSAGSIPGVNTTAEQKTFPSIQV----------HGYRGRAVVVVCVTKEGPEH
1ei5A           YHSDELDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLS
3bx2B           -------------------------------------------------------------LCDKLLALV


                         *         .         .         .         .         +         .:560
query           QNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEHGL
1bvoA           KPHPHNLVGKEGCKKGVCTV-----EINSTTMSYTFNNLGIQCVKKKDVEEALRLRQEIRVDPFRTGFGH
1ei5A           VGCWLRGVEYRRVQ--------------------------------------------------------
3bx2B           DKLTLDPFGNYVVQYIITNKYDYTHKIVHLLKPRAIELSIHKNVIEKILK--TAIVSEPMILEILNN---


                         .         .         .         *         .         .         .:630
query           RSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPALEQLLLASLQTASEGxxxxxxxxxxxxxxxx
1bvoA           AKEPGSIDLNAVRLCFQVFLEGQQRGRF----TEPLTPVVSDIIYDK-----------------------
1ei5A           ----------------------------------------------------------------------
3bx2B           --GGETGIQSLLNDSYGNYVLQTISHKQNDYLYKRLSEIVAPLLVGPIRNTPHG----------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bvoA           ------------------------------------------------------------
1ei5A           ------------------------------------------------------------
3bx2B           ------------------------------------------------------------