[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58871.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "2bmvA.bssp"
#ERROR : Can't open dsspfile "2arkC.bssp"
#ERROR : Can't open dsspfile "2arkF.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "1czhA.bssp"
#ERROR : Can't open dsspfile "1czkA.bssp"
#ERROR : Can't open dsspfile "1czrA.bssp"
#ERROR : Can't open dsspfile "2b3dB.bssp"
#ERROR : Can't open dsspfile "1czlA.bssp"
#ERROR : Can't open dsspfile "2amjC.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "2b3dA.bssp"
#ERROR : Can't open dsspfile "2bn4B.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"
#ERROR : Can't open dsspfile "2bn4A.bssp"
#ERROR : Can't open dsspfile "1bu5A.bssp"
#ERROR : Can't open dsspfile "1akwA.bssp"
#ERROR : Can't open dsspfile "2amjB.bssp"
#ERROR : Can't open dsspfile "2arkE.bssp"
#ERROR : Can't open dsspfile "1akqA.bssp"
#ERROR : Can't open dsspfile "2d5iA.bssp"
#ERROR : Can't open dsspfile "2bpoA.bssp"
#ERROR : Can't open dsspfile "1azlA.bssp"
#ERROR : Can't open dsspfile "1amoA.bssp"
#ERROR : Can't open dsspfile "1ag9A.bssp"
#ERROR : Can't open dsspfile "1dx9A.bssp"
#ERROR : Can't open dsspfile "1ahnA.bssp"
#ERROR : Can't open dsspfile "1c7eA.bssp"
#ERROR : Can't open dsspfile "2bf4A.bssp"
#ERROR : Can't open dsspfile "1akrA.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"
#ERROR : Can't open dsspfile "1aktA.bssp"
#ERROR : Can't open dsspfile "2amjD.bssp"
#ERROR : Can't open dsspfile "1bvyF.bssp"
#ERROR : Can't open dsspfile "3brcA.bssp"
#ERROR : Can't open dsspfile "3brcB.bssp"
#ERROR : Can't open dsspfile "2amjA.bssp"
#ERROR : Can't open dsspfile "1b1cA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1e5dA.bssp"

## Summary of PDB Search
:200
    3e-40  63%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    9e-39  65%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    2e-37  63%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    2e-36  44%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-33  43%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    5e-31  15%  2bmvA  [x.x.x] FLAVODOXIN
    6e-30  27%  2arkC  [x.x.x] FLAVODOXIN
    6e-30  27%  2arkF  [x.x.x] FLAVODOXIN
    7e-30  27%  2arkB  [x.x.x] FLAVODOXIN
    1e-29  27%  2arkA  [x.x.x] FLAVODOXIN
    8e-29  17%  1czhA  [c.23.5] FLAVODOXIN
    1e-28  17%  1czkA  [c.23.5] FLAVODOXIN
    1e-28  17%  1czrA  [c.23.5] FLAVODOXIN
    1e-28   8%  2b3dB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    3e-27  16%  1czlA  [c.23.5] FLAVODOXIN
    6e-26  10%  2amjC  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    4e-25  23%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    1e-24  10%  2b3dA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-24  13%  2bn4B  [x.x.x] NADPH CYTOCHROME P450 REDUCTASE
    4e-24  23%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    7e-24  19%  2bn4A  [x.x.x] NADPH CYTOCHROME P450 REDUCTASE
    2e-23  16%  1bu5A  [c.23.5] PROTEIN (FLAVODOXIN)
    3e-23  16%  1akwA  [x.x.x] FLAVODOXIN
    3e-23   7%  2amjB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    5e-23  26%  2arkE  [x.x.x] FLAVODOXIN
    2e-22  17%  1akqA  [x.x.x] FLAVODOXIN
    2e-22  22%  2d5iA  [x.x.x] AZO REDUCTASE
    3e-22  18%  2bpoA  [x.x.x] NADPH-CYTOCHROM P450 REDUCTASE
    3e-22  16%  1azlA  [x.x.x] FLAVODOXIN
    4e-22  15%  1amoA  [c.23.5 - b.43.4 - c.25.1] NADPH-CYTOCHROME P450 REDUCTASE
    4e-22  17%  1ag9A  [c.23.5] FLAVODOXIN
    5e-22  16%  1dx9A  [c.23.5] FLAVODOXIN
    1e-21  16%  1ahnA  [x.x.x] FLAVODOXIN
    1e-21  16%  1c7eA  [c.23.5] FLAVODOXIN
    2e-21  18%  2bf4A  [x.x.x] NADPH-CYTOCHROME P450 REDUCTASE
    4e-21  16%  1akrA  [x.x.x] FLAVODOXIN
    4e-21  32%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
    1e-20  16%  1aktA  [x.x.x] FLAVODOXIN
    1e-19  12%  2amjD  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-19  21%  1bvyF  [c.23.5] PROTEIN (CYTOCHROME P450 BM-3)
    6e-19  13%  3brcA  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    3e-17  10%  3brcB  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    3e-16  13%  2amjA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    2e-15  15%  1b1cA  [c.23.5] PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
    1e-11  14%  1dxqA  [c.23.5] QUINONE REDUCTASE
    1e-09  11%  1d4aA  [c.23.5] QUINONE REDUCTASE
    6e-05  20%  1e5dA  [d.157.1 - c.23.5] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
3b6iA           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKT-QTAPVATPQELADY
3b6mA           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGK-TQTAPVATPQELADY
3b6mB           --KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVA-TPQELADY
2a5lA           -PYILVLYYSRHGATA-EARQIARGVEQ-GGFEARVRTVPAVST--------------ALYATLEDLKNC
2a5lB           -PYILVLYYSRHGATA-EARQIARGVEQ-GGFEARVRTVPAVSTEALYA-------------TLEDLKNC
2bmvA           --KIGIFFGTDSGNAEAIAEKISKAIG-----NAEVVDVAK--------------------ASKEQFNSF
2arkC           -GKVLVIYDTRTGNTKKAELVAEGARS-LEGTEVRLKHVDE--------------------ATKEDVLWA
2arkF           -GKVLVIYDTRTGNTKKAELVAEGARS-LEGTEVRLKHVDE--------------------ATKEDVLWA
2arkB           AGKVLVIYDTRTGNTKKAELVAEGARS-LEGTEVRLKHVDE--------------------ATKEDVLWA
2arkA           AGKVLVIYDTRTGNTKKAELVAEGARS-LEGTEVRLKHVDE--------------------ATKEDVLWA
1czhA           --KIGLFYGTQTGVTQTIAESIQQEFGGESIVDLN----------------------DIANADASDLNAY
1czkA           --KIGLFYGTQTGVTQTIAESIQQEFGGESIVDL----------------------NDIANADASDLNAY
1czrA           --KIGLFYGTQTGVTQTIAESIQQEFGGESIVDL----------------------NDIANADASDLNAY
2b3dB           -SNILIINGAKAHSNGQLNDTLTEVAD--GTLRDLGHDVRIVRADS----------DYDVKAEVQNFLWA
1czlA           --KIGLFYGTQTGVTQTIAESIQQEFGG----------------------ESIVDLNDIANADASDLNAY
2amjC           -SNILIINGAKQLN-DTLTEVADGTLRD-LGHDVRIVRADSDYDVK---------------AEVQNFLWA
3edoB           --KTLILYYSWSGETKKAEKINSEIKDSLKEVKVSEGTFDADYKTSDIALDQIQGNKDFPELDNIDYNNY
2b3dA           -SNILIINGAKKHSNGQLNDTLTEVAD--GTLRDLGHDVRIVRADS----------DYDVKAEVQNFLWA
2bn4B           -KNYLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDF-------------------ESLNDVP
3edoA           --KTLILYYSWSGETKKAEKINSEIKDSLKEVKVSEGTFDADYKTSDIALDQIQGNKDFPELDNIDYNNY
2bn4A           NKNYLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDFE-------------------SLNDVP
1bu5A           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
1akwA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
2amjB           SSNILIINGANGQLNDTLTEVADGTLRDLGHDVRIVRADSDYDVKAEV----------------QNFLWA
2arkE           --KVLVIYDTRTGNTKKAELVAEGARSL-EGTEVRLKHVDEATK--------------------EDVLWA
1akqA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
2d5iA           -SKVLVLKSSIYSQSNQLSDYFVEQWREHSADEITVRDLAANRPSDAPLTPRQQEALALSDELIAELKAH
2bpoA           -KNYLVLYASQTGTAEGFAKAFSKELVAKFNLNVMCADVENYDF-------------------ESLNDVP
1azlA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
1amoA           GRNIIVFYGSQTGTAEEFANRLSKDAHR-YGMRGMSADPEEYDLADLSS---------------LPEIDK
1ag9A           --ITGIFFGSDTGNTENIAKMIQKQLGK----------------------DVAD-VHDIAKSSKEDLEAY
1dx9A           --KIGLFYGTQTGKTESVAEIIRDEFGN----------------------DVVT-LHDVSQAEVTDLNDY
1ahnA           --ITGIFFGSDTGNTENIAKMIQKQLGK----------------------DVAD-VHDIAKSSKEDLEAY
1c7eA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAGGL-------------------FEGF
2bf4A           -KNYLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDFESL-------------------NDVP
1akrA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
3d7nA           -SNTVVVYHSGYGHTH-RAEAVAEGAEA--------------------TLHAIDAEGNLSEDGWAALDAA
1aktA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAGGL-------------------FEGF
2amjD           SSNILIINGAKNDTLTEVADGTLRDLG----HDVRIVRADSD---------------YDVKAEVQNFLWA
1bvyF           -TPLLVLYGSNMGTAEGTARDLADIA-MSKGFAPQVATLDS---------------------HAGNLPRE
3brcA           ---------------DLIGKAYLESAERSEEVEAIRKYIRSARRTVVPNWNAEKVDAINDVLRSFNLREA
3brcB           ---------------DLIGKAYLESADRRRGDRSEEKYIRSARRTVVPNWNAEKVDAINDVLRSFNLREA
2amjA           -SNILIINGAKGQLNDTLTEVADGTLRD-LGHDVRIVRADSDYDVK---------------AEVQNFLWA
1b1cA           GRNIIVFYGSQTGTAEEFANRLSKDAH-RYGMRGMSADPEEYDLAD--------------LSSLPEIDNA
1dxqA           ARRALIVLAHSESFNYAMKEAAVEALKKRGW-EVLESDLYAMNFNPIISRNDITGELKDSVAEHKKLEAA
1d4aA           ------------GWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLVAEQKKLEAA
1e5dA           -------------------------------------------------------------------SDA


                         .         .         *         .         .         .         .:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
3b6iA           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTG-GGQEQTITSTWTTLAHHGMVI
3b6mA           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGT-GGGQEQTITSTWTTLAHHGMVI
3b6mB           DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGT-GGGQEQTITSTWTTLAHHGMVI
2a5lA           AGLALGSPTRFGNA-SPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSL-LPLLHHGLVL
2a5lB           AGLALGSPTRFGNA-SPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSL-LPLLHHGLVL
2bmvA           TKVILVAPTGAGDLQTDWEDFLGTLEASDFAN----KTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKV
2arkC           DGLAVGSPT-NGLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAC---SILTLNFGFLV
2arkF           DGLAVGSPT-NGLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAC---SILTLNFGFLV
2arkB           DGLAVGSPT-NGLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAC---SILTLNFGFLV
2arkA           DGLAVGSPT-NGLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAC---SILTLNFGFLV
1czhA           DYLIIGCPTWGGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQD--AMGILEEKISSLGSQT
1czkA           DYLIIGCPTNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQN--AMGILEEKISSLGSQT
1czrA           DYLIIGCPTNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGNQVGYSDNFQD--AMGILEEKISSLGSQT
2b3dB           DVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDGRTDPSKKYGSGGLVQGKKYMLSLTWNAPMEAF
1czlA           DYLIIGCPTNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQD--AMGILEEKISSLGSQT
2amjC           DVVIW--QPGWWGAPWTVKKYIDDV---FTEGHGTLYASDKKYGSGGLVQGKKYLSLTWNAPEAFTEKDQ
3edoB           DLILIGSPVWSGYPATPIKTLLDQKN-------YRGEVASFFTSAGTNHKAYVSHFNEWADGLNVIGVAR
2b3dA           DVVIWQMPGWWMGAPWTVKKYIDDVGTLYASDGRTRKDPSKKYGSGGLVQGKKYMLSLTWNAPMEAFTEK
2bn4B           VIVSIFISTYGEGDFPDGAVNFEDFICNAEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIR
3edoA           DLILIGSPVWSGYPATPIKTLLDQKN-------YRGEVASFFTSAGTNHKAYVSHFNEWADGLNVIGVAR
2bn4A           VIVSIFISTGEGDFPDGAVNFEDFICNAE-AGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIR
1bu5A           DLVLLGCSTWGDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEI
1akwA           DLVLLGCSTWLDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEI
2amjB           DVVIWQPGWW--GAPWTVKKYIDDVFTEGHGTLYASDGRTKYGSGGL-VQGKKYLSLTWNAPEAFTEKDQ
2arkE           DGLAVGSPTN-GLVSWKKRFFDDVLGDLW--GEIDGKIACAFSSSGGWGGGNEVAC---SILTLNFGFLV
1akqA           DLVLLGCSTWGDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGASSYEYFCGAVDAIEEKLKNLGAEI
2d5iA           DVIVIAAPMYNFNISTQLKNYFDLYTENGPEGLVTGKKAIVITSRGGIHKDGPTDTPYLSTFLGFIGITD
2bpoA           VIVSIFISTYGGDFPDGAVNFEDFICN-AEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIR
1azlA           DLVLLGCSTWVDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEI
1amoA           SLVVFCMATYGGDPTDNAQDFYDWLQETD--VDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQR
1ag9A           DILLLGIPTYYGEAQCDWDDFFPTLEEID----FNGKLVALFGCGDQEDYAEYFALGTIRDIIEPRGATI
1dx9A           QYLIIGCPTNIGELQSDWEGLYSELDDVD----FNGKLVAYFGTGDQIGYADNFQIGILEEKISQRGGKT
1ahnA           DILLLGIPTYYGEAQCDWDDFFPTLEEID----FNGKLVALFGCGDQEDYAEYFCLGTIRDIIEPRGATI
1c7eA           DLVLLGCSTWGDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGESSYEYFCGAVDAIEEKLKNLGAEI
2bf4A           VIVSIFISTYGGDFPDGAVNFEDFI-CNAEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIR
1akrA           DLVLLGCSTWADDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEI
3d7nA           DAIIFGTPT-YGGPSWQFKKFADASSKPWFSAKWQDKVFGGFTNSASLNGDKLNTLQYLVLLAGQHGGLW
1aktA           DLVLLGCSTWNDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEI
2amjD           DVVIWQPG--WWGAPWTVKKYIDDVFTEGHSGGLVQGKKYLSLTWNAPEAFTEKD-QFFHGVGVDGVYLP
1bvyF           GAVLIVTASYNGHPPDNAKQFVDWLDQAS-ADEVKGVRYSVFGCGDKNWATTQKVPAFIDETLAAKGAEN
3brcA           EHLQFNTNWADLTRPAVTKALALLVIARGRLGVPGSGSLLVIDSRGRLLSAASPPHVIHSEVREAVRSET
3brcB           EHLQFNTNWADLTRPAVTKALALDVIARGRLGVPGSGSLLVIDSRGRLLSAASPPHVIHSEVREAVRSET
2amjA           DVVIWQPGW--WGAPWTVKKYIDDDGRKYGSGGLVQGKKYLSLTWNAPDQFFHGVGVDGVYLPFHKANQF
1b1cA           LVVFCMATYGEGDPTDNAQDFYDWLQ--ETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQR
1dxqA           DLVIFQFPLQWFGVPAILKGWFERVLVAG-----------------------------------------
1d4aA           DLVIFQFPLQWFGVPAILKGWFERYAAMYDKGPFRSKKAVLSITTMYSLQGIHGDMNVILWPIQSGILHF
1e5dA           GAVIVGSPTHNNGILPYVAGTLQYIKGLR----PQNKIGGAFGS----FGWSGESTKVLAEWLTGMGFDM


                         +         .         .         .         .         *         .:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE
3b6iA           VPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
3b6mA           VPIGY---------AAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL--
3b6mB           VPIGYAAQE--------GGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVK---
2a5lA           -GI--------------PYTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGK---
2a5lB           -GIP-----------YSEPTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGK---
2bmvA           VGQTSTDGYHEASKAVEGGKFVGLV----IDEDNQDDLTDERISKWVEQVKGSF------
2arkC           FGVTDY------------VGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVD
2arkF           FGVTDY------------VGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVD
2arkB           FGVTDY------------VGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVD
2arkA           FGVTDY------------VGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVD
1czhA           VGYWPIEGYDFNESKAVRNNQFVG---LAIDEDNQPDLTKNRIKTWVSQLKSEF------
1czkA           VGYWPIEGYDFNESKAVRNNQFVG---LAIDEDNQPDLTKNRIKTWVSQLKSEF------
1czrA           VGYWPIEGYDFNESKAVRNNQFVG---LAIDEDNQPDLTKNRIKTWVSQLKSEF------
2b3dB           TEKDQFVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRYTEEYRKHLVEIF--------
1czlA           VGYWPIEGYDFNESKAVRNNQFVG---LAIDEDNQPDLTKNRIKTWVSQLKSEF------
2amjC           FFHGVGVDGVYLPFHKANQ-FLGEPTFIANDVIKPDVPRYTEEYRKHLVEIF--------
3edoB           DD----------------------------------------------------------
2b3dA           DQFFHGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRYTEEYRKHLVEIF--------
2bn4B           LGKLGEADDGAGTTDEDYMAWKDSILEVLKDELHLDEQEAKFTSQFQYTVLNEI------
3edoA           DDSE--------------------------------------------------------
2bn4A           LGKLGEA-----------------------------------------------------
1bu5A           VQDGLRIDGDPRAAR---------------------------------------------
1akwA           VQDGLRIDGDPRAAR---------------------------------------------
2amjB           FFHGVGVDGVYLPFH-KANQFLGEPTFIANDVIKPDVPRYTEEYRKHLVEIF--------
2arkE           FGVTDY------------VGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAIFVD
1akqA           VQDGLRIDGDPRAAR---------------------------------------------
2d5iA           VKFVFAE-----------------------------------------------------
2bpoA           LGKLGEADDGAGTTD---------------------------------------------
1azlA           VQDGLRIDGDPRAAR---------------------------------------------
1amoA           IF----------------------------------------------------------
1ag9A           VGHWPTAGYHFEASKGLADDDHFVGLAID----------EDRQPELTAERVEKWVKQISE
1dx9A           VGYWSTDGYDFNDSKALRNGKFVG---LALDEDNQSDLTDDRIKSWVAQLKSEF------
1ahnA           VGHWPTAGYHFEASKGLADDDHF----------VGLAIDEDRQPELTAERVEKWVKQISE
1c7eA           VQDGLRIDGDPRAAR---------------------------------------------
2bf4A           LGKLGEADDGAGT-----------------------------------------------
1akrA           VQDGLRIDGDPRAAR---------------------------------------------
3d7nA           VSLGY------------------------IAPAQSESVGDLETARLYGARVANVARQ---
1aktA           VQDGLRIDGDPRAAR---------------------------------------------
2amjD           FHKA----------NQFLGEPLPTF--IANDVIKPDVPRYTEEYRKHLVEIF--------
1bvyF           IADRGEADASDDFEG---------------------------------------------
3brcA           HALER-------------------------------------------------------
3brcB           H-----------------------------------------------------------
2amjA           LGEPL-------------------PTFIANDVIKPDVPRYTEEYRKHLVEIF--------
1b1cA           I-----------------------------------------------------------
1dxqA           ------------------------------------------------------------
1d4aA           CGFQV-------------------------------------------------------
1e5dA           PATPV-------------------------------------------------------