[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "2dk8A.bssp"
#ERROR : Can't open dsspfile "2co5B.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "2co5A.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"

## Summary of PDB Search
:163
    3e-06  26%  1dpuA  [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    4e-06  14%  2dk8A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    6e-06  15%  2co5B  [x.x.x] VIRAL PROTEIN F93
    8e-06  16%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    4e-04  12%  2co5A  [x.x.x] VIRAL PROTEIN F93
    8e-04  12%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    8e-04  10%  1aoyA  [x.x.x] ARGININE REPRESSOR
:163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
1dpuA           -----------------------------------ANGLTVAQNQVLNLIKARPEGLNFQDLKNQL----
2dk8A           --------------------------------------PVEIENRIIELCHQFPHGITDQVIQNEM----
2co5B           ----------------------------------KYMRINYYIILKVLVING-SRLEKKRLRSEILKRFD
1bibA           -------------------------------------KDNTVPLKLIALLAN-GEFHSGEQLGETL----
2co5A           -------------------------------------YMRINYYIILKVLVINGSRLEKKRLREILKRFD
1biaA           ------------------------------------MKDNTVPLKLIALLA-NGEFHSGEQLGETL----
1aoyA           ---------------------------------RSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGF


                         .         .         *         .         .         .         .:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIxxxxxx
1dpuA           KHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD------------------------------------
2dk8A           PHIEAQQRAVAINRLLSMGQLDLLRSNTGLL---------------------------------------
2co5B           IDISDGVLYPLIDSLIDDKILREEE---------------------------------------------
1bibA           -GMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQ------
2co5A           IDISDGVLYPLIDSLIDDKILREEE---------------------------------------------
1biaA           -GMSRAAINKHIQTLRDWGVDVFTVPGKGYS---------------------------------------
1aoyA           DNINQSKVSRMLTKFGAVRTRNAK----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxx
1dpuA           -----------------------
2dk8A           -----------------------
2co5B           -----------------------
1bibA           -----------------------
2co5A           -----------------------
1biaA           -----------------------
1aoyA           -----------------------