[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA58884.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bpiA.bssp"
#ERROR : Can't open dsspfile "2a03A.bssp"
#ERROR : Can't open dsspfile "1dt0A.bssp"
#ERROR : Can't open dsspfile "2awpA.bssp"
#ERROR : Can't open dsspfile "1dt0C.bssp"
#ERROR : Can't open dsspfile "2awpB.bssp"
#ERROR : Can't open dsspfile "2bkbA.bssp"
#ERROR : Can't open dsspfile "2cdyD.bssp"
#ERROR : Can't open dsspfile "1b06A.bssp"
#ERROR : Can't open dsspfile "2cdyA.bssp"
#ERROR : Can't open dsspfile "2cw3A.bssp"
#ERROR : Can't open dsspfile "2cdyB.bssp"
#ERROR : Can't open dsspfile "3dc5C.bssp"
#ERROR : Can't open dsspfile "1d5nA.bssp"
#ERROR : Can't open dsspfile "1cojA.bssp"
#ERROR : Can't open dsspfile "2cw3B.bssp"
#ERROR : Can't open dsspfile "3dc5A.bssp"
#ERROR : Can't open dsspfile "2cw2A.bssp"
#ERROR : Can't open dsspfile "2cw2B.bssp"
#ERROR : Can't open dsspfile "2ce4A.bssp"
#ERROR : Can't open dsspfile "3bfrA.bssp"
#ERROR : Can't open dsspfile "3c3sA.bssp"
#ERROR : Can't open dsspfile "1ap6A.bssp"
#ERROR : Can't open dsspfile "3dc6C.bssp"
#ERROR : Can't open dsspfile "3ceiA.bssp"
#ERROR : Can't open dsspfile "3ceiB.bssp"
#ERROR : Can't open dsspfile "3c3tA.bssp"
#ERROR : Can't open dsspfile "2adpA.bssp"
#ERROR : Can't open dsspfile "2adqB.bssp"
#ERROR : Can't open dsspfile "3dc6A.bssp"
#ERROR : Can't open dsspfile "2ce4B.bssp"
#ERROR : Can't open dsspfile "1ar4A.bssp"
#ERROR : Can't open dsspfile "2aw9B.bssp"
#ERROR : Can't open dsspfile "2cdyC.bssp"

## Summary of PDB Search
:193
    2e-81  54%  2bpiA  [x.x.x] FE-SUPEROXIDE DISMUTASE
    2e-81  55%  2a03A  [x.x.x] FE-SUPEROXIDE DISMUTASE HOMOLOG
    2e-77  65%  1dt0A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    2e-77  55%  2awpA  [x.x.x] IRON SUPER-OXIDE DISMUTASE
    3e-77  66%  1dt0C  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    5e-76  55%  2awpB  [x.x.x] IRON SUPER-OXIDE DISMUTASE
    5e-75  70%  2bkbA  [x.x.x] SUPEROXIDE DISMUTASE [FE]
    9e-75  51%  2cdyD  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    9e-75  39%  1b06A  [a.2.11 - d.44.1] PROTEIN (SUPEROXIDE DISMUTASE)
    1e-74  51%  2cdyA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    6e-74  44%  2cw3A  [x.x.x] IRON SUPEROXIDE DISMUTASE
    1e-73  49%  2cdyB  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-71  39%  3dc5C  [x.x.x] SUPEROXIDE DISMUTASE [MN] 2
    8e-71  45%  1d5nA  [a.2.11 - d.44.1] PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)
    8e-71  31%  1cojA  [a.2.11 - d.44.1] PROTEIN (SUPEROXIDE DISMUTASE)
    8e-71  45%  2cw3B  [x.x.x] IRON SUPEROXIDE DISMUTASE
    1e-70  39%  3dc5A  [x.x.x] SUPEROXIDE DISMUTASE [MN] 2
    8e-70  56%  2cw2A  [x.x.x] SUPEROXIDE DISMUTASE 1
    1e-69  56%  2cw2B  [x.x.x] SUPEROXIDE DISMUTASE 1
    2e-69  53%  2ce4A  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-66  37%  3bfrA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    6e-60  43%  3c3sA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-58  43%  1ap6A  [a.2.11 - d.44.1] MANGANESE SUPEROXIDE DISMUTASE
    7e-58  39%  3dc6C  [x.x.x] SUPEROXIDE DISMUTASE [MN] 1
    1e-57  52%  3ceiA  [x.x.x] SUPEROXIDE DISMUTASE
    6e-57  52%  3ceiB  [x.x.x] SUPEROXIDE DISMUTASE
    1e-56  43%  3c3tA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-56  43%  2adpA  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    6e-56  44%  2adqB  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    1e-53  40%  3dc6A  [x.x.x] SUPEROXIDE DISMUTASE [MN] 1
    5e-52  53%  2ce4B  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    7e-52  38%  1ar4A  [a.2.11 - d.44.1] SUPEROXIDE DISMUTASE
    5e-33  53%  2aw9B  [x.x.x] SUPEROXIDE DISMUTASE [MN]
    2e-30  52%  2cdyC  [x.x.x] SUPEROXIDE DISMUTASE [MN]
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
2bpiA           --ITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQ
2a03A           MAITLPKLKYALNALSPHISEETLSFHYNKHHAGYVNKLNGLIKDTPLANKSLTDILKESTGAIFNNAAQ
1dt0A           --FELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSGGIFNNAAQ
2awpA           MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQ
1dt0C           --FELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSGGIFNNAAQ
2awpB           --IILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQ
2bkbA           -SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAE
2cdyD           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVLRNNAGG
1b06A           -RYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDRLKLIKGDLPQGQYDLQGILTFNING
2cdyA           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQLDRVLRNNAGG
2cw3A           SSGLRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLRAGENVFNAAGQ
2cdyB           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEEFADLPVEQLIQQLDRKGALRNNAGG
3dc5C           MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAIALQPALKFNGGGH
1d5nA           -SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESPEFANLPVEELITKLDQLLRNNAGG
1cojA           --HKLEPKDHLKPQNLEGISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFADRSKANQNYSEETFNYMG
2cw3B           LRM---TLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATGLPESRINLKSLVTLRAGENVFNAAGQ
3dc5A           --HTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAIALQPALKFNGGGH
2cw2A           GPFQCPPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTETGKPFNQAAQ
2cw2B           --FQCPPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTETGKPFNQAAQ
2ce4A           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKAL-ETEFADLPVEQLIQQKKGALRNNAGG
3bfrA           --VTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANQNIKFHGGG
3c3sA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPLKFNGGG
1ap6A           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPLKFNGGG
3dc6C           MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKNVKEAIALQPALKFNGGG
3ceiA           --FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQ
3ceiB           --FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQ
3c3tA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPLKFNGGG
2adpA           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVN-NLNVTEEKYQEALAKGDVTAQIALQPLKFNGGG
2adqB           --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPLKFNGGG
3dc6A           --HSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPLKFNGGG
2ce4B           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQDKKGALRNNAGG
1ar4A           -VYTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANTALDKLEARDKADFGAINKLEKDLAFNLAG
2aw9B           --YTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQDKKGALRNNAGG
2cdyC           LAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQKKGALRNNAGG


                         .         .         *         .         .         .         .:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
2bpiA           IWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTH
2a03A           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKDQFSNVLCGHFGSGWGWLALNKNNKLVILQTH
1dt0A           VWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
2awpA           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTH
1dt0C           VWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKADGSLALASTI
2awpB           IWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTH
2bkbA           VWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTS
2cdyD           HANHSMFWQIMGQGQANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
1b06A           HKLHAIYWNNMAPKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDNSGNLQIMTVE
2cdyA           HANHSMFWQIMGQGQANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
2cw3A           IYNHNMYWLSMVPGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTERRLDLVGTK
2cdyB           HANHSMFWQIMGQ-GQNQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
3dc5C           I-NHSIFWTNLAK-DGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATC
1d5nA           HANHSLFWKGLKK--GTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLK-GDKLAVVSTA
1cojA           VVLHELYFGMLTPGGKGEPSEALKKKIEEDIGGLDACTNELKAAAMAFRGWAILGLDIF-SGRLVVNGLD
2cw3B           IYNHNMYWLSMVPGSGRHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDTERRLDLVGTK
3dc5A           I-NHSIFWTNLAK-DGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATC
2cw2A           VYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-DGKLKIVQGH
2cw2B           VYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-DGKLKIVQGH
2ce4A           HANHSMFWQIMGQ--ANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
3bfrA           FTNHCLFWENLAPEGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNNGGKLDVVQTY
3c3sA           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
1ap6A           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
3dc6C           HINHSIFWTNLAK-DGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGCPKGKILKVATCA
3ceiA           IYNHDFYWDCLSP-KATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAANLDTQKIEIIQTS
3ceiB           IYNHDFYWDCLSP-KATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAANLDTQKIEIIQTS
3c3tA           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
2adpA           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
2adqB           HINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
3dc6A           HINHSIFWTNLAK-DGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGCPKGKILKVATCA
2ce4B           HANHSMFWQIMGQ-GANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
1ar4A           HVNHSVFWKNMAPKGSARPTDELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVDPLGKRINTLQFY
2aw9B           HANHSMFWQIMGQGQGNQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA
2cdyC           HANHSMFWQIMGQGQANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-DGKLDVVSTA


                         +         .         .         .         .         *         .:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAN
2bpiA           DAGNPIKDNTIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENLKK
2a03A           DAGNPIKENTIPILTCDVWEHAYYIDYRNDRLSYVKAWWNLVNWNFANENLKN
1dt0A           GAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAEQFEG
2awpA           DAGNPIKDTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKK
1dt0C           GAGCPLTIGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAEQFE-
2awpB           DAGNPIKDTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKK
2bkbA           NAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLA-
2cdyD           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1b06A           NHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRLQ-
2cdyA           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2cw3A           DAHSPLSEGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL--
2cdyB           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
3dc5C           ANQDPLE-GMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFAN
1d5nA           NQDSPLMGSGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFA-
1cojA           AHNVYNLTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVVNERFEK
2cw3B           DAHSPLSEGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWSLINWEFADSNL--
3dc5A           ANQDPLE-GMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFAN
2cw2A           DAGNPIRESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWNLVNWDFVNDNVA-
2cw2B           DAGNPIRESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWNLVNWDFVNDNVAK
2ce4A           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
3bfrA           NQDTVTGP-LVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFD-
3c3sA           NQDPLQTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
1ap6A           NQDPLQTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
3dc6C           NQDPLEATGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFA-
3ceiA           NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYE-
3ceiB           NAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYE-
3c3tA           NQDPLQTTGLIPLLGIDVWDHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
2adpA           NQDPLQTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
2adqB           NQDPLQTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
3dc6A           NQDPLETTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFA-
2ce4B           NQDNPLMGSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
1ar4A           DHQNNLPAGSIPLLQLDMWEHAFYLQYKNVKGDYVKSWWNVVNWDDVALRFS-
2aw9B           NQDNPLMVSGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-
2cdyC           NQDNPLMGEGTPILGVDVWEHAYYLNYQNRRPDYLAAFWNVVNWDEVSKRYA-