[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA59023.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "3douA.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "2br3D.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "2aotB.bssp"
#ERROR : Can't open dsspfile "2br3B.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "2bm8A.bssp"
#ERROR : Can't open dsspfile "2br5E.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "2bm8B.bssp"
#ERROR : Can't open dsspfile "2br5D.bssp"
#ERROR : Can't open dsspfile "2br4A.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3bt7A.bssp"
#ERROR : Can't open dsspfile "2bm9B.bssp"
#ERROR : Can't open dsspfile "2br4F.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"
#ERROR : Can't open dsspfile "2br3F.bssp"
#ERROR : Can't open dsspfile "2bm8K.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "3bwyA.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "2aowA.bssp"
#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "2br3A.bssp"
#ERROR : Can't open dsspfile "3cjtC.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "2aouB.bssp"
#ERROR : Can't open dsspfile "2br5F.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "3e05G.bssp"
#ERROR : Can't open dsspfile "3cjqA.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "3e05E.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "3cjqG.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "2bm8G.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "3cjtG.bssp"
#ERROR : Can't open dsspfile "2an4A.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "3c6mD.bssp"
#ERROR : Can't open dsspfile "2an4B.bssp"
#ERROR : Can't open dsspfile "3bgdA.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "2ekmA.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"

## Summary of PDB Search
:212
    3e-17  56%  1eizA  [c.66.1] FTSJ
    4e-13  12%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    1e-12  30%  3douA  [x.x.x] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
    1e-11  12%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    3e-11  11%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    5e-11  11%  2br3D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-10  13%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-10  12%  2aotB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    4e-08  11%  2br3B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-07  24%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    1e-07  11%  2bm8A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-07  11%  2br5E  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-07  21%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    5e-07   9%  2bm8B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-07  14%  2br5D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-07  13%  2br4A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-07  12%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    6e-07  10%  3bt7A  [x.x.x] TRNA (URACIL-5-)-METHYLTRANSFERASE
    7e-07   9%  2bm9B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    8e-07   9%  2br4F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-06  17%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-06  16%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-06  13%  2br3F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-06  12%  2bm8K  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-06  14%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    2e-06  13%  3bwyA  [x.x.x] COMT PROTEIN
    4e-06  10%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    4e-06   8%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    5e-06  24%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-06  20%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    8e-06  24%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    1e-05  15%  2aowA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    1e-05  10%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    1e-05  14%  2br3A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-05  22%  3cjtC  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-05  23%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-05  14%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    4e-05  18%  2aouB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    4e-05  14%  2br5F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-05  22%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    5e-05  23%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    6e-05  12%  3e05G  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    6e-05  17%  3cjqA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    7e-05  12%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    9e-05  22%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    9e-05  13%  3e05E  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-04  17%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-04  13%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    1e-04  10%  3c3pC  [x.x.x] METHYLTRANSFERASE
    1e-04  19%  3cjqG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-04  20%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-04  11%  2bm8G  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-04  13%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-04  21%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-04  13%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    2e-04  16%  3cjtG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-04  18%  2an4A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    4e-04  12%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    5e-04  17%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    5e-04  18%  3c6mD  [x.x.x] SPERMINE SYNTHASE
    6e-04  17%  2an4B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    6e-04  13%  3bgdA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    6e-04  22%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    6e-04  10%  2ekmA  [x.x.x] HYPOTHETICAL PROTEIN ST1511
    7e-04  14%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
1eizA           ---------------------------GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
2admA           ----------------------------------------------APRGGRVLEPACAHGPFLRAFREA
3douA           ----------------------------LRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSL
2cl5A           -----QNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARL
2cl5B           ----QQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARL
2br3D           ---RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
1aqiA           ----------------------------------------------APRGGRVLEPACAHGPFLRAFREA
2aotB           MRSLFSDHGKY-VESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSK
2br3B           ---RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
1aqjB           ----------------------------------------------APRGGRVLEPACAHGPFLRAFREA
2bm8A           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2br5E           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
3eeyA           ------------------------------------------IKMFVKEGDTVVDATCGNGNDTAFLASL
2bm8B           -------LDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2br5D           ---RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2br4A           -RPRDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRD-
3e05A           ----------------------------------------------LQDDLVMWDIGAGSASVSIEASNL
3bt7A           ----------RLPVAGKEIYRQVENSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARN
2bm9B           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2br4F           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2br5A           ---RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRKI
2br5C           ---RDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDI
2br3F           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
2bm8K           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
3c6kB           -------------HSKQFGNILILSGDVNLAESDLAYTRAIMGSGKDYTGKDVLILGGGDGGILCEIVKL
3bwyA           ----LQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARL
3dxzA           ---------------------------------------LDFPALFGREAPVTLEIGFGMGASLVAMAKD
2dpmA           -------------------------------------------------RILYMLRVNFNGLYRVNSKNQ
1aqjA           ----------------------------------------------APRGGRVLEPACAHGPFLRAFREA
3eeyI           ---------------------------------LTIKNSLGQSHDYVKEGDTVVDATCGNGNDTAFLASL
3a25A           ------------------------------AKIMFSPANVKERVRVAKPDELVVDMFAGIGHLSLPIAVY
2aowA           --RSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSK
3cbgA           ------------------------------------------------GAKQVLEIGVFRGYSALAMALQ
2br3A           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
3cjtC           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
3eeyB           ----------------------------------------------VKEGDTVVDATCGNGNDTAFLASL
2an3A           ----RFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATG--EVSGRTLIDIGSGPTVYQLLSACS
2aouB           MRSLFSDHGKY-VESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSK
2br5F           -RPRDWPLDRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
3cjqD           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
3bkxA           ---------KRLDYITDLALGPTANARTIQRRQTAHRLAIAEAWQV-KPGEKILEIGCGQGDLSAVLADQ
3e05G           ----------------------------------------------LQDDLVMWDIGAGSASVSIEASNL
3cjqA           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
3egiB           ---------SRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQS-FKCDVVVDAFCGVGGNTIQFALT
3eeyC           ------------------------------------------IKMFVKEGDTVVDATCGNGNDTAFLASL
3e05E           ----------------------------------------------LQDDLVMWDIGAGSASVSIEASNL
3cjtA           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
3bwmA           -----QHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARL
3c3pC           ----------------------------------------------IKQPQLVVVPGDGLGCASWWFARA
3cjqG           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
3cjrA           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
2bm8G           ---------RWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAVYHDMLWRPRTIVELGVYNGGSLAWFRDL
3dulB           ------------KDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVIQGARNILEIGTLGGYSTIWLARG
3eeyF           ------------------------------------------IKMFVKEGDTVVDATCGNGNDTAFLASL
3c6mB           ----------KILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKDYTGKDVLILGGGDGGILCEIVKL
3cjtG           --------APWHTWEGAE-IPLVIEPGGTGHAETTRLA-LKALARHLRPGDKVLDLGTGSGVLAIAAEK-
2an4A           ----RFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATG--EVSGRTLIDIGSGPTVYQLLSACS
3e05B           ----------------------------------------------LQDDLVMWDIGAGSASVSIEASNL
2an3B           ----RFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATG--EVSGRTLIDIGSGPTVYQLLSACS
3c6mD           ----------------------------------------------DYTGKDVLILGGGDGGILCEIVKL
2an4B           ---QRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATG--EVSGRTLIDIGSGPTVYQLLSACS
3bgdA           ----VQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQ-SGLRVFFPLCGKAIEMKWFADR
3eeyG           ------------------------------------------IKMFVKEGDTVVDATCGNGNDTAFLASL
2ekmA           ----------------------------------------------TVEDLYETLASSSPHLKFGIAFCE
3dxyA           ---------------------------------------LDFPALFGREAPVTLEIGFGMGASLVAMAKD


                         .         .         *         .         .         .         .:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
1eizA           IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
2admA           HGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLIPPYGIVGVFKAVKDLYKKAFSTWKGKYN
3douA           ---ARKIISIDLQEEEIAGVRFIRCDIFKETIFDDIDRALREEGIVDDVVSDAA--KVSGIPSRDHAVSY
2cl5A           LQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLI--PQLKKKYDVDTLDMVFLDHWKDRY
2cl5B           LQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLP
2br3D           TKIMGIDCQVIGIDRDLSRCQIPASDMENITLH--------QGDCSDLTTFEHLREMAHPLIFIDDAHAN
1aqiA           HGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVKAVKDLYKKAFSTWKGKYN
2aotB           VQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKWDFIHMIQMLYYVK
2br3B           TKIMGIDCQVIGIDRDLSRCQIPASDMENITLH--------QGDCSDLTTFEHLREMAHPLIFIDDAHAN
1aqjB           HGTGYRFVGVEIDP--------------------------------------------------------
2bm8A           TKIMGIDCQVIGIDRDLS--------RCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHAN
2br5E           TKIMGIDCQVIGIDRDLSRCQIPASDMENITLH--------QGDCSDLTTFEHLREMAHPLIFIDNAHAN
3eeyA           VGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNDCPVKAVMFNLGYLPSGDHSISTRPETT
2bm8B           TKIMGIDCQVIGIDR------------DLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDN
2br5D           TKIMGIDCVIGIDRDLSRCQIPASDMENITLHQGDCTFEHLREMAHPLIFIDNAH-------------AN
2br4A           -------LTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHAN
3e05A           MPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEI-------
3bt7A           FDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRL-QGIDLKSYQCETIFVDP
2bm9B           TKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLI--FIDNAHANTFNI--
2br4F           TKIMGIDCQVIGIDRDLSRCQIPASDENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNI-----
2br5A           MGIDCQVIGIDRDLSRDMENITLHQGDCSDL----TTFEHLREMAHPLIFIDNAH-------------AN
2br5C           MGIDCQVIGIDRDLSRDMENITLHQGDCSDL----TTFEHLREMAHPLIFIDNAH-------------AN
2br3F           TKIMGQVIGIDRDLSRIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDA-------------HAN
2bm8K           TKIMGIDCQVI--------GIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHAN
3c6kB           KP--KMVTMVEIDQNLKGDCYQVLIEDCIPV----LKRYAKEGREFDYVINDLTAVPIS----TSPSTWE
3bwyA           LSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLP
3dxzA           -RPEQDFLGIEVHSPGSAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQ-
2dpmA           FN---VPYGRYKNPKIISVYINNNQLEIKVGDFEKAIVD---VRTGDFVYFDPPYIPLFTSYTHEGFSFA
1aqjA           HGTGYRFVGVEIDP--------------------------------------------------------
3eeyI           VGENGRVFGFDIQDKAIADRVTLIKDGHQNMDKYIDCP-------VKAVMFNLGYLPSGDHSISTRPETT
3a25A           G--KAKVIAIEKDPYTFEDRMSAYNMDNRD----------------------------------------
2aowA           VQ--AQYPGVCINN--------------------------------------------------------
3cbgA           LPPDGQIIACDQDP----NATAIAKKYWQKAGVAEKISLRLGPALATLEQLTQGKPLPEFDLIFIDADKR
2br3A           TKIMG--------IDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHAN
3cjtC           ---GGKALGVDIDPVLPQAEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAEL-------------
3eeyB           VGENGRVFGFDIQDKALIDRVTLIKDGHQNMDKYIDCP-------VKAVMFNLGYLPSGDHSISTRPETT
2an3A           HFE--DITMTDFLEVNRQFNWSMYSQHACL----IEGKGECWQDKERQLRARVKRVLPIDVHQPQP----
2aouB           V---QAQYPGVI----------------------------------------------------------
2br5F           TK--IMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCHLREMAHPLIFIDNAHANTFNIMKWA-----
3cjqD           ---GGKALGVDIDPVLPQAEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAEL-------------
3bkxA           VGSSGHVTGIDIAS--------------------------------------------------------
3e05G           MPNGRIFALERNPQYLGF-IRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFI-----GGSGGMLEE--
3cjqA           GGKALGV-------DIDPMVLPQAEANAKRNGV-------RPRFLEGSLEAALPFGPFDLLVANLYAELH
3egiB           GRVIAIDIDPVKIALAIADKIEFICGDFLLLASFLKADVVFLSPPWAETFDIRTSPDGFEIFRLSKKITN
3eeyC           VGENGRVFGFDIQDKALIDRVTLIKDGHQNMDKYIDCP-------VKAVMFNLGYLPSGDHSISTRPETT
3e05E           MPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE--------
3cjtA           G---GKALGV----DIDPMVLPQAEANAKRNGV----RPRFLEGSLEAALPFGPFDLLVANLYAELHAAL
3bwmA           LSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLP
3c3pC           IS-ISSRVVIDPDRDN----VEHARRLHDNGLI---------DRVELQVGDPLGIAAGQRDIDILFDCDV
3cjqG           ---GGKALGVDIDPMVLPQAEANAKRNGVR-------------PRFLEGSLEAALPFGPFDLLVANLYAE
3cjrA           G---GKALGVDIDPEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGR-
2bm8G           TKIMGIDCQVIGIDRDLSRCQIPASDMENITLH--------QGDCSDLTTFEHLREMAHPLIFIDNAHAN
3dulB           LSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAY
3eeyF           VGENGRVFGFDIQDKAIANTTKKLTDLNLIDRVTHQNMDKYIDCPVKAVMFNLGYLPSGDHSISTRPETT
3c6mB           KPKMVTMVEIDVLDNLKGDCYQVLIEDCIPV----LKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLI
3cjtG           --LGGKALGV----DIDPMVLPQAEANAKRNGV----RPRFLEGSLEAALPFGPFDLLVANLYAELHAAL
2an4A           HFE--DITMTDFLE--------------------------------------------------------
3e05B           MPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE--------
2an3B           HF--EDITMTDFLE--------------------------------------------------------
3c6mD           KPKYMRKTCGDVLDNLKGDCYQVLIEDCIPV----LKRYAKEGREFDYVINDLTAVPISTSTWEFLRLIL
2an4B           HF--EDITMTDFLE--------------------------------------------------------
3bgdA           GHTVVGVEAEQNLSYTEEPLAEIAGAKVFKSS--------------------------------------
3eeyG           VGENGRVFGFDIQDKALIDRVTLIKDGHQNMDKYIDCP-------VKAVMFNLGTRPET-----------
2ekmA           ASGKRLIRWDGNDEEIGAGHTFVIYIKNGFPINVLNRIKNVEE-VVRIFAATANPLQVLVAETDQGRGVI
3dxyA           RPE-QDFLGIEVHSPGGLSNLRVMCHDAVEV--LHKMIPDNSLRMVQLFFPDPWHKAR------HNKRRI


                         +         .         .         .         .         *         .:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKxxx
1eizA           LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVA--------
2admA           LYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKV----------
3douA           QIGQRVEIAVRYLRNGGNVLLKQFQGDTNDFI-AIWRKNFSSYKISKP------SSEIYIFFGF------
2cl5A           LPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEK--------
2cl5B           --DTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEK--------
2br3D           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVLRR---
1aqiA           LYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSV----------------------
2aotB           DIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQ-------------
2br3B           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
1aqjB           ----------------------------------------------------------------------
2bm8A           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
2br5E           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
3eeyA           IQALS-----------------------------------------------------------------
2bm8B           AFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
2br5D           TFNIMKWAVDHLLEEGDYFIIEDMIPYAFRDVLSMDMLYANASSQLDRGVLR------------------
2br4A           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEMDMLYANASSQLDRGVLRRV------------
3e05A           -----IDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTK----------------
3bt7A           PRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQFPYTHHMQCGV---------
2bm9B           ----MKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
2br4F           ----MKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
2br5A           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEMDMLYANASSQLDRGVLRRV------------
2br5C           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFR--------------------------
2br3F           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
2bm8K           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
3c6kB           FLRLILDLSMKVLKQDGKYFTQGNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSELWVFYTVWKKAK---
3bwyA           --DTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSS------------------------------
3dxzA           --VPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESN---------------------
2dpmA           DQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEI----------------------
1aqjA           ----------------------------------------------------------------------
3eeyI           IQALS-----------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
2aowA           ----------------------------------------------------------------------
3cbgA           NYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEVDPQEAQTQVLQQFNRDLAQDERVRISVIP--------
2br3A           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEMDMLYANASSQLDRGVLRRV------------
3cjtC           -HAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----AAEGEWVLLAYGR------
3eeyB           IQALSKAMELLVTGGIITVVIYYGGDTGFEEKFIVQRTDF-INQANCPPI--------------------
2an3A           ----------------------------------------------------------------------
2aouB           ----------------------------------------------------------------------
2br5F           --------VDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRLSMDMLYANASSQL------------
3cjqD           -HAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----AAEGEWVLLAYGR------
3bkxA           ----------------------------------------------------------------------
3e05G           ----IIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAK------------------
3cjqA           --AALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----AAEGEWVLLAYGR------
3egiB           PRNADIDQVASLAGPGGQVEIEQNFLNNTAYFGDLIR---------------------------------
3eeyC           IQALS-----------------------------------------------------------------
3e05E           ----IIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGLVYIITAWKS-----
3cjtA           APRYR-----EALVPGGRALLTGILKDRAPLVREAMAGGFRPLEE------AAEGEWVLLAYGR------
3bwmA           --DTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSS------------------------------
3c3pC           FNGADVLERNRCLAKNALLIAVNALRRGLREFNHHLSRRRDFFTTIVP----------------------
3cjqG           LHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----AAEGEWVLLAYGR------
3cjrA           ------ALLTGILKDRAPLVREAMAGAGFRPLEEAAEGEWVLL---------------------------
2bm8G           TFNIMKWAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDR--------
3dulB           FEWAL-----KLSRPGTVIIGDNVVREGEVIIRRFYELIAAEPRVS------------------------
3eeyF           IQALS-----------------------------------------------------------------
3c6mB           LDLSMKV-----LKQDGKYFTQGNLTEALSLYEEQLGRLYCPVEFSKEIVC-------------------
3cjtG           APRYR-----EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEE-----AAEGEWVLLAYGR------
2an4A           ----------------------------------------------------------------------
3e05B           ----IIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAK------------------
2an3B           ----------------------------------------------------------------------
3c6mD           DLSMKV------LKQDGKYFTQGNLTEALSLYEEQLGRLYCPVEFSKEIV--------------------
2an4B           ----------------------------------------------------------------------
3bgdA           ----------------------------------------------------------------------
3eeyG           ----------------------------------------------------------------------
2ekmA           GVVDGYTETEADIKERKELLR-------------------------------------------------
3dxyA           VQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSS--------------------------------


                         .         .         .         +         .         .         .:280
query           xx
1eizA           --
2admA           --
3douA           --
2cl5A           --
2cl5B           --
2br3D           --
1aqiA           --
2aotB           --
2br3B           --
1aqjB           --
2bm8A           --
2br5E           --
3eeyA           --
2bm8B           --
2br5D           --
2br4A           --
3e05A           --
3bt7A           --
2bm9B           --
2br4F           --
2br5A           --
2br5C           --
2br3F           --
2bm8K           --
3c6kB           --
3bwyA           --
3dxzA           --
2dpmA           --
1aqjA           --
3eeyI           --
3a25A           --
2aowA           --
3cbgA           --
2br3A           --
3cjtC           --
3eeyB           --
2an3A           --
2aouB           --
2br5F           --
3cjqD           --
3bkxA           --
3e05G           --
3cjqA           --
3egiB           --
3eeyC           --
3e05E           --
3cjtA           --
3bwmA           --
3c3pC           --
3cjqG           --
3cjrA           --
2bm8G           --
3dulB           --
3eeyF           --
3c6mB           --
3cjtG           --
2an4A           --
3e05B           --
2an3B           --
3c6mD           --
2an4B           --
3bgdA           --
3eeyG           --
2ekmA           --
3dxyA           --