[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA59402.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c52B.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "1amkA.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "1bkhB.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "3dipB.bssp"
#ERROR : Can't open dsspfile "3dwjA.bssp"
#ERROR : Can't open dsspfile "2dw6A.bssp"
#ERROR : Can't open dsspfile "3e5bD.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "3eahB.bssp"
#ERROR : Can't open dsspfile "3dipA.bssp"
#ERROR : Can't open dsspfile "2bahA.bssp"
#ERROR : Can't open dsspfile "3e5bB.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"
#ERROR : Can't open dsspfile "3bsmA.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "3c4uA.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "3e7mA.bssp"
#ERROR : Can't open dsspfile "3dwjB.bssp"
#ERROR : Can't open dsspfile "1b9bA.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "3b8iB.bssp"
#ERROR : Can't open dsspfile "3ct2A.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "3bjsA.bssp"
#ERROR : Can't open dsspfile "2dp3A.bssp"
#ERROR : Can't open dsspfile "1dtnA.bssp"
#ERROR : Can't open dsspfile "1df1A.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "3c5xA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "3b8iD.bssp"
#ERROR : Can't open dsspfile "2a4aB.bssp"
#ERROR : Can't open dsspfile "3dg3A.bssp"
#ERROR : Can't open dsspfile "1bkhC.bssp"
#ERROR : Can't open dsspfile "3bjsB.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "3cb3B.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "1dbtA.bssp"
#ERROR : Can't open dsspfile "1dkwB.bssp"
#ERROR : Can't open dsspfile "2abbA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "3bpwB.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "1dbtB.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "3e65B.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "2dzwB.bssp"
#ERROR : Can't open dsspfile "3cb3A.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "3e49A.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "2a7nA.bssp"
#ERROR : Can't open dsspfile "2bznC.bssp"
#ERROR : Can't open dsspfile "3c52A.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2dzsA.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"
#ERROR : Can't open dsspfile "3e7gA.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "3ceuB.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "3b8iC.bssp"
#ERROR : Can't open dsspfile "2a7rD.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "2dztA.bssp"
#ERROR : Can't open dsspfile "2c6qG.bssp"
#ERROR : Can't open dsspfile "2agkA.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "3dg6A.bssp"
#ERROR : Can't open dsspfile "2btmA.bssp"
#ERROR : Can't open dsspfile "1btmA.bssp"
#ERROR : Can't open dsspfile "1dd7A.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "3di0A.bssp"
#ERROR : Can't open dsspfile "3di0B.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "3cjpA.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "3e7sB.bssp"
#ERROR : Can't open dsspfile "2c18B.bssp"
#ERROR : Can't open dsspfile "3di1B.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "3c0jA.bssp"
#ERROR : Can't open dsspfile "2a6lA.bssp"
#ERROR : Can't open dsspfile "2dzpB.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "2e09A.bssp"
#ERROR : Can't open dsspfile "2c3zA.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "2dzpA.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "2dzuA.bssp"
#ERROR : Can't open dsspfile "2dzwA.bssp"
#ERROR : Can't open dsspfile "3b4uA.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "3daqA.bssp"
#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "1dwxA.bssp"
#ERROR : Can't open dsspfile "2dzvB.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "2dzxA.bssp"
#ERROR : Can't open dsspfile "2dzsB.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "3di1A.bssp"
#ERROR : Can't open dsspfile "3denA.bssp"
#ERROR : Can't open dsspfile "2a6nA.bssp"
#ERROR : Can't open dsspfile "3c56B.bssp"
#ERROR : Can't open dsspfile "3bggA.bssp"
#ERROR : Can't open dsspfile "2dztB.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "3eahA.bssp"
#ERROR : Can't open dsspfile "2dzvA.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "1ea0A.bssp"
#ERROR : Can't open dsspfile "2dzaB.bssp"
#ERROR : Can't open dsspfile "3barA.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "3dqsA.bssp"
#ERROR : Can't open dsspfile "1dvjC.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "1dwxB.bssp"
#ERROR : Can't open dsspfile "3eb2A.bssp"
#ERROR : Can't open dsspfile "3dz1A.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "3dfyB.bssp"
#ERROR : Can't open dsspfile "1dkwA.bssp"
#ERROR : Can't open dsspfile "3dfyL.bssp"
#ERROR : Can't open dsspfile "3eisA.bssp"
#ERROR : Can't open dsspfile "3dfyF.bssp"
#ERROR : Can't open dsspfile "3e68B.bssp"
#ERROR : Can't open dsspfile "1dvjA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "3dqtB.bssp"
#ERROR : Can't open dsspfile "3cb3C.bssp"
#ERROR : Can't open dsspfile "3e7gC.bssp"
#ERROR : Can't open dsspfile "3dfyE.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "3dfyH.bssp"
#ERROR : Can't open dsspfile "3dfyN.bssp"
#ERROR : Can't open dsspfile "3eegA.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"

## Summary of PDB Search
:337
    6e-33   9%  3c52B  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    2e-32  11%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    3e-32  11%  1amkA  [x.x.x] TRIOSE PHOSPHATE ISOMERASE
    6e-32  14%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    9e-32  11%  1bkhB  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-31   9%  3dfhA  [x.x.x] MANDELATE RACEMASE
    4e-31  13%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    5e-31   8%  3dipB  [x.x.x] ENOLASE
    2e-30  11%  3dwjA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-30  12%  2dw6A  [x.x.x] BLL6730 PROTEIN
    1e-29   9%  3e5bD  [x.x.x] ISOCITRATE LYASE
    1e-29  12%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    3e-29   8%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    3e-29   9%  3eahB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    3e-28   9%  3dipA  [x.x.x] ENOLASE
    4e-28  12%  2bahA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    4e-28  11%  3e5bB  [x.x.x] ISOCITRATE LYASE
    9e-28  12%  2dw7A  [x.x.x] BLL6730 PROTEIN
    2e-27   9%  3bsmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-27   8%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    2e-27  14%  3c4uA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    5e-27  13%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    2e-26  13%  3e7mA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-26  14%  3dwjB  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-26  10%  1b9bA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    7e-26   9%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    3e-25   9%  3b8iB  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    3e-25  12%  3ct2A  [x.x.x] MUCONATE CYCLOISOMERASE
    6e-25  11%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    7e-25  14%  3bjsA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    9e-25  12%  2dp3A  [x.x.x] TRIOSEPHOSPHATE ISOMERASE
    1e-24  11%  1dtnA  [x.x.x] MANDELATE RACEMASE
    4e-24  12%  1df1A  [d.174.1] NITRIC OXIDE SYNTHASE
    5e-24  16%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    1e-23   9%  3c5xA  [x.x.x] ENVELOPE PROTEIN E
    2e-23  14%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    3e-23  11%  3b8iD  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    3e-23  14%  2a4aB  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-23  11%  3dg3A  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-23  11%  1bkhC  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    5e-23  13%  3bjsB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-22  11%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    3e-22  11%  2e77C  [x.x.x] LACTATE OXIDASE
    4e-22  10%  3cb3B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-21  14%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    2e-21   9%  1dbtA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-21  13%  1dkwB  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    3e-21  15%  2abbA  [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    4e-21  12%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    8e-21  12%  2a7rC  [x.x.x] GMP REDUCTASE 2
    2e-20  11%  3bpwB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-20  12%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    2e-20  10%  1dbtB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-20   9%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    4e-20  11%  2bznB  [x.x.x] GMP REDUCTASE 2
    5e-20  12%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-19  15%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-19  14%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    2e-19  12%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-19  12%  2a1yA  [x.x.x] GMP REDUCTASE
    2e-19  15%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-19  12%  2e77B  [x.x.x] LACTATE OXIDASE
    2e-19  12%  3e65B  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-19  10%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    4e-19  11%  2dzwB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-19  11%  3cb3A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    8e-19  15%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    8e-19  10%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    9e-19  10%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    9e-19  10%  3e49A  [x.x.x] UNCHARACTERIZED PROTEIN DUF849 WITH A TIM BARREL
    1e-18  16%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    1e-18  11%  2a7nA  [x.x.x] L(+)-MANDELATE DEHYDROGENASE
    2e-18  10%  2bznC  [x.x.x] GMP REDUCTASE 2
    4e-18  10%  3c52A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    5e-18  11%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    7e-18  12%  2du2A  [x.x.x] LACTATE OXIDASE
    1e-17  15%  2dzsA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-17  11%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-17   8%  3e7gA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-17  11%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    4e-17  11%  2e77A  [x.x.x] LACTATE OXIDASE
    8e-17   8%  3ceuB  [x.x.x] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    1e-16  11%  2bleA  [x.x.x] GMP REDUCTASE I
    1e-16  12%  2bznA  [x.x.x] GMP REDUCTASE 2
    1e-16   9%  3b8iC  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-16  10%  2a7rD  [x.x.x] GMP REDUCTASE 2
    2e-16  10%  2a7rA  [x.x.x] GMP REDUCTASE 2
    3e-16   9%  2csbA  [x.x.x] TOPOISOMERASE V
    4e-16  12%  2bznD  [x.x.x] GMP REDUCTASE 2
    4e-16  13%  2dztA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-16  10%  2c6qG  [x.x.x] GMP REDUCTASE 2
    1e-15  14%  2agkA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    1e-15  14%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-15   9%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    1e-15  12%  2bwgB  [x.x.x] GMP REDUCTASE I
    2e-15  11%  2bwgA  [x.x.x] GMP REDUCTASE I
    2e-15  11%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-15  14%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-15  10%  3dg6A  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-15  15%  2btmA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    6e-15  13%  1btmA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    6e-15  13%  1dd7A  [d.174.1] INDUCIBLE NITRIC OXIDE SYNTHASE
    8e-15  14%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-14  15%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-14  11%  3di0A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-14  11%  3di0B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-14  14%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-14  10%  2c6qA  [x.x.x] GMP REDUCTASE 2
    2e-14   9%  2c6qB  [x.x.x] GMP REDUCTASE 2
    2e-14  15%  3cjpA  [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY
    3e-14  13%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    3e-14  11%  3e7sB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    8e-14  13%  2c18B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    9e-14  11%  3di1B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-13   8%  1dqwA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-13  13%  2bwgD  [x.x.x] GMP REDUCTASE I
    2e-13  12%  3c0jA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-13  13%  2a6lA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-13  14%  2dzpB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-13  12%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    1e-12  16%  2e09A  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-12  11%  2c3zA  [x.x.x] INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE
    2e-12   9%  3b5vA  [x.x.x] RETROALDOLASE-22
    3e-12  15%  2dzpA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-12  15%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-12  15%  2dzuA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-12  15%  2dzwA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-12  12%  3b4uA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-12  10%  1a53A  [c.1.2 (1lbfA)] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    1e-11  11%  3daqA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-11  14%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-11  12%  1dwxA  [d.174.1] NITRIC OXIDE SYNTHASE
    3e-11  15%  2dzvB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-11  12%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    3e-11  15%  2dzxA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-11  13%  2dzsB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-11  10%  2a7rB  [x.x.x] GMP REDUCTASE 2
    5e-11  11%  3di1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    8e-11  12%  3denA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    8e-11  16%  2a6nA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-10  11%  3c56B  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    1e-10  11%  3bggA  [x.x.x] URIDINE 5'-MONOPHOSPHATE SYNTHASE
    5e-10  12%  2dztB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-09  12%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-09  10%  3eahA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    1e-08  12%  2dzvA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-08  11%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    1e-08  10%  1ea0A  [d.153.1 - c.1.4 - b.80.4] GLUTAMATE SYNTHASE [NADPH] LARGE
    2e-08  14%  2dzaB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-08  10%  3barA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    4e-08  12%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-07   7%  3dqsA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    1e-06  13%  1dvjC  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-06  11%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    3e-06  11%  1dwxB  [d.174.1] NITRIC OXIDE SYNTHASE
    4e-06  16%  3eb2A  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    7e-06  12%  3dz1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-06  15%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    9e-06  17%  3dfyB  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-05  15%  1dkwA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    2e-05  18%  3dfyL  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-05   9%  3eisA  [x.x.x] ARYLMALONATE DECARBOXYLASE
    2e-05  18%  3dfyF  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-05   9%  3e68B  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-05  13%  1dvjA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    4e-05  10%  1efzA  [c.1.20] TRNA-GUANINE TRANSGLYCOSYLASE
    5e-05   9%  3dqtB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    6e-05  14%  3cb3C  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    6e-05   9%  3e7gC  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    3e-04  18%  3dfyE  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-04  13%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    5e-04  17%  3dfyH  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-04  16%  3dfyN  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-04  14%  3eegA  [x.x.x] 2-ISOPROPYLMALATE SYNTHASE
    8e-04  16%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
3c52B           -----------------------LVKGNEILLKAHKEGYGVMLNAIFEAGNEENSPLFIQASEGAIKYMG
1bkhA           -----------------------IGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLG-----
1amkA           ---------------------VHIPLVQAKLRNPKYVISENAIAKSGAFTGEVSMPILKDIGVH----WV
1djqA           -----------SARIWDEGDVRNLKAMTDEVHKYGALAGVELWY-GGAHAPNMESRATPRGPSQYAFETL
1bkhB           --------GIKANIDAHLAPALIGLAADNI-NAAMLKLDKLAKGNTFAKSGIESALLDAQGKRL------
3dfhA           -----------------------IEDLWQMMMVNAYWRNGPVINNAISGVDMALWDIKAKLAGMPFGGKS
1djnA           -----------SARIWDEGDVRNLKAMTDEVHKYGALAGVELWY-GGAHAPNMESRATPRGPSQYAFETL
3dipB           --------------------------------------------RAASAVDIALWDLAGQRAGVPLHVAL
3dwjA           ---------------------------------------------------------TLHHKA-----TS
2dw6A           -----------------------VWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAEH
3e5bD           -----------------------------APKGRFDGIERAHT--AEDVKRLRGSVEIKYSLAEMGRLWK
3egbB           ----------------------------------------------VKYGELVVLGKSRFALY--KRPKA
1chrA           -----------------------------------TDAFNVSGALQTMARAVTGNASAKAAVEMALLKAR
3eahB           ---------------------------------------------------------NWEVGSITYDTLS
3dipA           --------------------------------------------RAASAVDIALWDLAGQRALHVALGGA
2bahA           ------------------------PMYREETIAGALDLLRGTFLPAILGQTFA--------NPEAVSDAL
3e5bB           --------------DFYSLIPSAPKGRFDGIERAHTAELRGSVEIKYSLAEMGANRLWKLIHEEDFVNAL
2dw7A           ----------------------------------------------------------------------
3bsmA           -----------------------IEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAYQLLGGKS
3c6eA           ----------------------------------------------------------------------
3c4uA           --------------------------------------GNEILLKAHKEGYGVGAFNFVNFENAIFEAGN
1bwkA           ----------TEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFEKKSFVWVQLWVLGWAAFPDNLARDGLN
3e7mA           ----------------------------------------------NWGSGEILHDTLHHKATSDFTCLG
3dwjB           ---------------------------------------------------------TLHHKATSCLGSI
1b9bA           ---------------------TALSEVGEILSGRNIKLGAVFYEDQGAFTGEISPLMLQE----IGVEYV
3b8iA           ------------------------YHTASVFDPMSARIAADLGFECG-ILGGSVASLQVLAAPTRIGRVA
3b8iB           ------------------------YHTASVFDPMSARIAADLGFECG-ILGGSVASLQVLAAPDRIGRVA
3ct2A           -------------------APLLIGQDASNINAAMLRLEQSINTFAKSGIESALLDAQGKRLGLPVSELL
1bwlA           ------------WTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAQEAKAKKAN
3bjsA           ------------------------------------------------------RGKAANMPLYELLGGS
2dp3A           -------------------------TAIAANTSKQLRIANVYLEGNGAWTGETSVEMLQDMG----LKHV
1dtnA           ------------------------------------------------------LGKVHETPLVKLLGAN
1df1A           ----------------------------------------------------------------------
1d3hA           --------------------------NPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLT
3c5xA           ----------------------------------------------------------------------
1d3gA           -----SDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKVEHRLRARQQKQAKLT
3b8iD           -----------------------CYHTASVFDPMSARIAADLGFECG-ILGGSVASLQVLAAPDEQATRI
2a4aB           ----------------------SVICLTDHTEDDIRELCNESVKTCPF-AAAVCVYPKFVKFINEKIKKP
3dg3A           -----------------------IGLTLTEREVAHTRMARTVGNPTA-KAAIDMAMWDALGQSLRLGGYT
1bkhC           -----------------------IGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLG-----
3bjsB           ------------------------------------------------------RGKAANMPLYELLGGS
2an2A           ----------------------------------------------------------------------
2e77C           -----APDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGAT-FEEISEGL
3cb3B           -------------------------------------------TQAIGAFDVALWDLKAKRAGAKLLGSY
3ddmA           -------------------------------EARTAVLAIQTGEPAQAIAGLDIALCDLAARRAGQPLWA
1dbtA           ---------------------------LDFASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKE
1dkwB           --------------------------------------------------------------------WI
2abbA           ---------WKKITAGVHAEDGRIAVQLWHTGRISHSSIQPGGQAPVSASALNANTRTSLRDENGIRVDT
2e68B           -------------------------SCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHD
2a7rC           ----TRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPD---C
3bpwB           ----------------------------------CFYIINETNKYAKMNFAFYIPYGSIDVLKNVFDYLY
2a4aA           ------------------TDHTFLDENGTEDDI--RELCNE-SVKTCPFAAAVCVYPKFVKFINEKIKKP
1dbtB           ---------------------------LDFASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKE
1eepA           ---------------ISLNIPFLSSAMDTVTESQMAIAIAKIIHKNMSIEAQRKEIEKVKTYKDFPNACK
2bznB           --------SFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEF---AGQNPDC
3b8iE           -----------------------CYHTASVFDPMSARIAADLGFECG-ILGGSVASLQVLAAPTRIGRVA
2djxA           ---------KLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFHD
1al7A           ---------------------IMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSS--WATSSVEEVAST
2cu0A           --PKDVDVSTRITPNVKLNIPILSAAMDTVTEWEMAVAMAREGGLGVIHRNMGIEEQVEQVKRVK----R
2a1yA           -----ECDTTVTLGKHKFKLPVVPANMQTIIDERIATYLAENNYFYIMHRFQPEKRISFIRDMQ----SR
2b4gB           -----------------------IGKSCTLAPRTGNPEPRYFGLPLGSINSMGLPNLGVDFYLSYAAQTH
2e77B           -----APDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGA--TFEEISEG
3e65B           ----------------------------------------------------------------------
1eepB           --------KTQLTKNISLNIPFLSSAMDTVTESQMAIAIAKEGGIGIIHKNMSIEAQRKEIEYDFPNACK
2dzwB           -----------------KDGSLIPYLTAGDPDKQSTLNFLLALDEYAGAIELGIPFSDPIADGIQESHYR
3cb3A           -----AGGPGQFAHAREIAPAL-IGEDPSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALW--DLKAK
2b4gA           --------------------------SCTLAPRTGNPEPRYFGLPLGSINSMGLPNLGVDFYLSYAAQTH
3e7sA           ---------------------------------------------------------NWELGSITYDTLC
1eb3A           --------------------HTAEFLETEISSVLAGGY------NHPLLRQWQSERQLTKNMLIFPLFIS
3e49A           ----------------------------------------------------------------------
1al8A           ---------------------IMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEV--AST
2a7nA           ----------AEVLGKRQSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDL---AR
2bznC           -----RSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQ---NPDC
3c52A           -----------------------------------------YGVGAFNFVNFEMLNAIFEAGNEENSPLF
1b3oA           --------TSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKDYPLA
2du2A           -----APDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGEA
2dzsA           ----------------------------------------------------------------------
2dzxB           ------------------KDGSLIPYLTAGDPDKQSTLNFLLALDEAGAIELGIPFSDPIADGKTIQESH
3e7gA           ---------------------------------------------------------NWGSGMTFQDTLH
2cffA           -----------------------VVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKL-IEEGFTLIH
2e77A           -----APDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSE-FGTIMSISAYSGATFEEISEGL
3ceuB           ----------------------------------------------------------------------
2bleA           -----RTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNH---PEC
2bznA           -----RSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP---DC
3b8iC           ------------------------YHTASVFDPMSARIAADLGFECG-ILGGSVASLQVLAAPDEQATRI
2a7rD           ----TRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP---DC
2a7rA           ----TRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP---DC
2csbA           ---------------------------------------------GVKAYDGVLATRYLERSSAKNDEEL
2bznD           ---------------TYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEF---AGQNPDC
2dztA           ----------------------------------------------------------------------
2c6qG           -----RSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLC--KFSLFTAVHKHYSLVQWQEFAGQNPDCL
2agkA           ----------------------------------------------------------LGPNNDDAAREA
3c3nA           ---------KLNLLDHVFANPFMNAAGVLCSTEEDLRCMTAAVPLGSINSMGLPNLGFDFYLKYASDLHD
1b3oB           ----------------------------------------------------------------------
2bwgB           -----RTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHP---EC
2bwgA           -----RTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPE---C
3dgbA           -----------------------IGQDASNINAAMLRLEQSINTFAKSGIESALLDAQGKRLGLPVSELL
2djlA           ---------------------FMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFGF
3dg6A           ------------------------------------------------------------------ALGQ
2btmA           -----------------DEVISVVCAPFLFLDRLVQAADGMHFADQGAYTGEVSPVMLKDLG----VTYV
1btmA           ---------------------------------------TMHFADQGAYTGEVSPVMLKDLGVT----YV
1dd7A           ----------------------------------------------------------------------
2e68A           ---------KLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPMAFPLGSINSMGLP
3dfyA           ---------------ENAVREMITGIDVRNYARIFEITDRLF-GFPSLKAAVQFATLDALSQECYLLGGK
3di0A           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3c61A           ---------QVDLLNNTFANPFMNAAGVMCSTTEDLVAMTESA-SGSLVSKSCTPALREGNPAYAAEQHD
2c6qA           -----RSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEF---AGQNPDC
2c6qB           ---------FRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP---DC
3cjpA           -----------------------------IIDGHTHVILPVEKHIKIMDDKTILFSTSIHPETAVNLRDV
2cu0B           ------------------NIPILSAAMDTVTEWEMAVAMAREGGLGVIHRNMGIEEQVEQVKRVKRYKNA
3e7sB           ---------------------------------------------------------NWELGSITYDTLC
2c18B           -----------------------------------------------LTVDDLILPVFVLDGVNQRE---
3di1B           ----------------------------------------------------------------------
1dqwA           ATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKAF
2bwgD           ---------------------IIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPE---C
3c0jA           ----------------------------------------------------------------------
2a6lA           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
3b5vA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
3b4uA           ----------------------------------------------------------------------
1a53A           --------------------------------------------------------------FNKRNITA
3daqA           ----------------------------------------------------------------------
2dzuB           ----------------------------------------------------------------------
1dwxA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
1ak5A           --------QKGQQSEINLKIPLVSAIMQSVSGEKMAIALAREGGISFIFGSQSIESQAAMVHAVKAHNEL
2dzxA           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
2a7rB           ----TRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPD---C
3di1A           ----------------------------------------------------------------------
3denA           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
3c56B           ----------------------------------------------------------------------
3bggA           --------------------RAELPRIHPVASKLLRLMQKKET-NLCLSADVSLARELLQLADAPSICML
2dztB           ---------------------LIPYLTAGDPDKQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESH
2ehhC           ----------------------------------------------------------------------
3eahA           ---------------------------------------------------------NWEVGSITYDTLS
2dzvA           ---------------------LIPYLTAGDPDKQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESH
2aqwA           ----------------------------------------------------------------NVFDYL
1ea0A           -----------------------GAKSDSGEGGEDPARFRPDKNGDNWNSAIKQVASGRFGVTAEYL-NQ
2dzaB           ----------------------------------------------------------------------
3barA           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1dvjC           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
1dwxB           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
3dz1A           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
3dfyB           ---------------------------------------------------------------CYLLGGK
1dkwA           ----------------------------------------------------------------------
3dfyL           ---------------------------------------------------------------CYLLGGK
3eisA           ----------------------------------------------------------------------
3dfyF           ---------------------------------------------------------------CYLLGGK
3e68B           ----------------------------------------------------------------------
1dvjA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3e7gC           ----------------------------------------------------------------------
3dfyE           ---------------------------------------------------------------CYLLGGK
3eb2B           ----------------------------------------------------------------------
3dfyH           ---------------------------------------------------------------CYLLGGK
3dfyN           --------------------------------RIFEITDRLFGFPLKAAVQFATLSQELGTQVCYLLGGK
3eegA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
3c52B           IDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSK---VVKMA
1bkhA           ---LPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRE
1amkA           ILGHSERRTYYGETDEIVAQKVSEACKQGFM----VIACIGETLQQREANQTAKVVLSQTSAIAAKLTKD
1djqA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGANPYYNKRTDKYGGSLENRARFWLETLEKVKHA
1bkhB           --GLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRE
3dfhA           RDAIPVYTHATSDTMEGIYDLVEGFLEKGYKHIRCQLGFD------------QDQYMDNTLTMFKSLREK
1djnA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHA
3dipB           GGAARDRVPVYATFMRDAGVLAESLVAEGYAAMKIWPFDDFASITPHHISLTDLKDGLEPFRKIRAAVGQ
3dwjA           SIMNPKSLTRGPPLEELLPHAIEFINQYY-GSFKEAKIEEHLARL-EAVTKEIETTGTYQLTLDELIFAT
2dw6A           GVKANPRVFVPGKGLSMLRGEMRGYLDRGYNVVKMAIGGA-----------PIEEDRMRIEAVLEEIGKD
3e5bD           LIHEEDFVNALGALSGNQAQVAADANTASAMYPDQSLYPANAGPELAKRINRTLQRADQIEEGKGLSVDT
3egbB           NGVKPSTVHVISTCKGQHS--ISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDF--------VVTDT
1chrA           ALGVSIAELLGGPLRSAIPIAWTLASGDTKRDLDSAVEMIERRRHNRFKVKLGFRSPQDDLIHMEALSNS
3eahB           AQAQQDGPCTPRRCLGSLVFPPEQLLSQARDFINQYYSSQAHEQRLQEVEAEVAATGTYQLRESELVFGA
3dipA           ARDRVPVYATCAGYDFDAGVLAESLVAEGYAAMKIWPFDDFASITPHHISLTDLKDGLEPFRKIRAA---
2bahA           GSYRGNRMARAMV---EMAAWDLWARTLGVPLCTLLGGHKEQVEVGVSLGIQADEQATVVRRHVEQGYRR
3e5bB           GALSGAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRIN-RTLQRADQIETAEGKGLSVDT
2dw7A           -----------GKGLSMLRGEMRGYLDRGYNVVKMKIGGAP---------------IEEDRMRIEAVLEE
3bsmA           RERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGV----------PGSTEKYLNHAPKLFAAVRER
3c6eA           ----------------------------------QGMRCIG------MSNRDFVEGVSGGSWVDIVLEHG
3c4uA           EENSPLFIQAGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAMIDASHHAFEENLELTSKVVKMA
1bwkA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSLDPHSNTRTDEYGGSIENRARFTLEVVDALVEA
3e7mA           SIMNPKSLTRGPRDLEELLPHAIEFINQYYGSFKEA-KIEEHLARLEAVTKEIETTGTYLDELIFATKMA
3dwjB           MNPKSLTRRDKPTPLEELLPHAIEFINQYYGSFKEA-KIEEHLARLEAVTKEIETTGTYLDELIFATKMA
1b9bA           IVGHSERRRIFKEDDEFINRKVKAVLEKGMT----PILCVGETLEEREKGLTFCV----VEKQVREGFYG
3b8iA           RLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVD
3b8iB           RLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVD
3ct2A           GGRVRDALLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAG---------------EVDRDLAHVIAIKKA
1bwlA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIQFLDPHSNTRTDEYGGSIENRARFTLEVVDALEAI
3bjsA           KRRIPGGIALGYQPKESLAEEAQEYIARGYKALKLRIGDA----------------ARVDIERVRHVRKV
2dp3A           IVGHSERRRIMGETDEQSAKKAKRALEKGMT----VIFCVGETLDERKANRTMEVNIAQLEALGKEL--G
1dtnA           ARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPA---------------LDQDLAVVRSIRQA
1df1A           --SLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEA-KIEEHLARLEAVTKEIGTYQLTLDELIFATKMA
1d3hA           EDGLPLGVNLGKNKTSVDAAEGVRVLGPLADYLVVNVSSPNTAGLRSLGKAELRRLLTKVLQERDGLRRV
3c5xA           ----------------------------------QGMRCIG--MSNRDFVEG----VSGGSWVDIVLEHG
1d3gA           EDGLPLGVNLGKNKTSVDYAEGVRVLGPLADYLVVNVSSPNTA---GLGKAELRRLLTKVLQERDGLRRV
3b8iD           GRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFRSTDLICVEEGVGKIRAALEAR
2a4aB           KIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIEN------TDEGLKEATKLTQSVKKLL
3dg3A           DRMRVSHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRP---------------VQLDTAVVRALRER
1bkhC           ---LPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRE
3bjsB           KRRIPAGIALGYQPKESLAEEAQEYIARGYKALKLRIGDA----------------ARVDIERVRHVRKV
2an2A           ------------SHAAILWNEAK-----AFIAECYAELGKAEEVALDSIKSEIDLTGSYKEELEHGAKMA
2e77C           NGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRFGMIYGASKQKISPRDIEEIAGH
3cb3B           RDSVRCYNTSGGFLHT------PIDQLMVNASASIERGIGGIKLKVGQPD------GALDIARVTAVRKH
3ddmA           WLGDRIGVYASGINPENPEDVVARKAAEGYRAFKLKVGFD----------------DARDVRNALHVREL
1dbtA           RNCELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPAGKKRPSLIAVTQL
1dkwB           VLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGETLQERE--------SGRTAVVVLTQIAAIAKK
2abbA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCNE
2e68B           YSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPN--VPGKPQVAYDFEAMRTYLQQVSLA
2a7rC           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYS-----------------EHFVEFVKDVRKR
3bpwB           ELNIPTILDMKDIGNTVKNYRKFIFEYLKSDSCTVNIYMGTNMLKDICYDEEKNKYYSAFVLVKTTNPDS
2a4aA           KIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIENTDEGLKEATKLT------QSVKKLL
1dbtB           RNCELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPGKKRPSLIAVTQLT
1eepA           DLNNKLRVGAAVSIDIDTIERVEELVKAHVDILVIDSAHGHS--------------TRIIELIKKIKTKY
2bznB           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEH-----------------FVEFVKDVRKR
3b8iE           RLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFG--RKSTDLICVEEGVGKIRAALEAR
2djxA           YSKKPLFLSISGLSVVAMVRRLAPVAQEKGVLLELNLSCPNVPGK-----PQVAYDFEAMRTYLQQVSLA
1al7A           GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLG
2cu0A           AEKYKNAVRDENGELLVAAAVSPFDIKRAIELDKAGVDVIVVDT--------AHAHNLKAIKSMKEMRQK
2a1yA           GLIASISVGVKEDEYEFVQQLAAEHLTPEYITIDIAHGH-----------------SNAVINMIQHIKKH
2b4gB           DSRKPLFLSMSGLSVEESVKKLVPITKEKGTILELNLSCPNVP-----GKPQVGYDFDTTRTYLQKVSEA
2e77B           LNGGPRWFQIYMAKDDQNRDILDEAKSDGATAIILTADSTVSGEGMSLNNIYGASKQKISPRDIEEIAGH
3e65B           ---LTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLETKEIETTGTYQLTLDELIFATKMA
1eepB           DLNNKLRVGAAVSIDIDTIERVEELVKAHVDILVIDSAHGHS--------------TRIIELIKKIKTKY
2dzwB           ALKNGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEI
3cb3A           RAGLSLAKLLGSYRDSVRCYNTSGGFLHTPDQLMVNASASIERGIGGIKLKVGQPDGALDIARVTAVRKH
2b4gA           DYRKPLFLSMSGLSVEEMVKKLVPITKEKGTILELNLSCPN-----VPGKPQVGYDFDTTRTYLQKVSEA
3e7sA           AQSPCTPRRCLGSLVLPRK--EQLLSQARDFINQYYSSIKRSGSQAHEERLEVASTGTYHLRESELVFGA
1eb3A           FTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILF-GVPLIPGTKDPVGTAADDPAGPVIQGIKFIREY
3e49A           -------------------------------------------------DGRPTQDPAAFAEFLPRIKSN
1al8A           GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLIKNRFVLPPFLTLKDLGLSSYVAGQIDR
2a7nA           QCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLG
2bznC           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYS-----------------EHFVEFVKDVRKR
3c52A           IQASEGAIKYMGIDMAVGMVKIMCERGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNA
1b3oA           SKDAKKQLGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGN--------------SIFQINMIKYIKDKY
2du2A           KSDGATAIILTADSTVSGNRDRDVKNKFPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAGH
2dzsA           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQEKNGFKLREAFWIVKEFRRH
2dzxB           YRKNGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTE
3e7gA           HKALTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELL-PQAIEFVNGSFKEAKIEEHLARVEAVTKEIETT
2cffA           ---VVDLSNAIENSGENLPVLEKLSEFAEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSL
2e77A           NGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGMPIVQNNIYGASKQKISPRDIEEIAGH
3ceuB           -----LIVVTTPTFFVEEDKIITALFEEGLDILHLRKPETPAYSERLLTLIPEKYHRRIVTHEHFYLKEE
2bleA           LQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS-----------------EHFVEFVKLVRAK
2bznA           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLD-----------------VANGYSEHFVEFVKDVRKR
3b8iC           GRVARLPVIADAGNALNVMRTVVELERAGIAALTIEDTLLPAQFGR-KSTDLICVEEGVGKIRAALEARV
2a7rD           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLD-----------------VANGYSEHFVEFVKDVRKR
2a7rA           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEH-----------------FVEFVKDVRKR
2csbA           LELHQNFILLTGSYACSIDPTEDRYQNVIVRGVNFDERVQ-RLSTGGSPARYAIVYRRGWRAIAKALDID
2bznD           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYS-----------------EHFVEFVKDVRKR
2dztA           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
2c6qG           E-HLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYS-----------------EHFVEFVKDVRKR
2agkA           LQESPQFLQVGGGINDTNCLEW--LKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDRIVVDLSCRKT
3c3nA           YSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPG--KPQVAYDFEAMRTYLQQVSLA
1b3oB           --LVAIIARTDLKKNRDYPLASKDAKKQLLCGIGTHEDDKYRLDLLAQAGVDVVVLDS-SQGNSIFQINM
2bwgB           LQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEH-----------------FVEFVKLVRAK
2bwgA           LQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS-----------------EHFVEFVKLVRAK
3dgbA           GGRVRDALLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAGE---------------VDRDLAHVIAIKKA
2djlA           DFYLKYASDLHDYSKVAMVRRLAPVAQEKGVLLELNLSCPN-----VPGKPQVAYDFEAMRTYLQQVSLA
3dg6A           SLRLSVSEMLGGYTDRMRV-SHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRALRER
2btmA           ILGHSERRQMFAETDETVNKKVLAAFTRGLI----PIICCGESLEEREAGQTNAV----VASQVEKALAG
1btmA           ILGHSERRQMFAETDETVNKKVLAAFTRGLI----PIICCGESLEEREAGQTNAVVASQVEKALAGLTPE
1dd7A           ---NPKSLTRGPRDLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKETTGTYQLTLDELIFATKMA
2e68A           NLGFDFYLKYFLSISVAMVRRLAPVAQEKGVLLELNLSCPNVPGK-----PQVAYDFEAMRTYLQQVSLA
3dfyA           RDEIETDKTVGIDTVENRV---KEAK---------KIFEEGFRVIKIKVGENLKEDIEAVEEIAKVTRGA
3di0A           -----------------------------------------------------------------HLFEG
3di0B           -----------------------------------------------------------------HLFEG
3c61A           YGRKPLFLSMSGLSVREMCKRLAAVATEKGVILELNLSCPNV-----PGKPQVAYDFDAMRQCLTAVSEV
2c6qA           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLD-----------------VANGYSEHFVEFVKDVRKR
2c6qB           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGY-----------------SEHFVEFVKDVRKR
3cjpA           KKEMKKLNDVVNGKTNSMIDVRRNSIKELTNVIQAYPS---------RYVGFGNVPVGLSNDTNSYIEEN
2cu0B           VRDENGELLVAAAVSPFDIKRAIELDKAGVDVIVVDTAHA---------------HNLKAIKSMKEMRQK
3e7sB           AQSQDGPCTPRRCLGSLVLPPAEQLLSQARDFINQRSGSQAHEERLQEVEAEVASTGTYHLRESELVFQA
2c18B           --SIPSMPGVERLSIDQLLIEAEEWVALGIPALAL--FPVTPVEKKSLDAAEAYNPEGIAQRATRALRER
3di1B           -----------------------------------------------------------------HLFEG
1dqwA           LLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPG----------IVSGLKQAAEEVTKEPRG
2bwgD           LQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS-----------------EHFVEFVKLVRAK
3c0jA           ---------------------------------------------------------------FTGSIVA
2a6lA           ---------------------------------------------------------------FTGSIVA
2dzpB           -KDGSLYLTAGDPNKQSTLNFLL-ALDEYAGAIELGIPFSDPIADGKTIQESHYRALREAFWIVKEFRRH
3eb2D           ---------------------------------------------------------------FHGVFPY
2e09A           ------YLTAGDPDKQSTLNFL-LALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKAFRRH
2c3zA           --------------VERDPIEYSKFMERYAVGLSILTEEKYRKIASSVSIPILMKDFIVKESQIDDAYNL
3b5vA           -------------DVERDPIEYSKFMERYAVGLSITTEAKYFILMADFIVKESQIDDAYNLGADTVALIV
2dzpA           ------YLTAGDPNKQSTLNFL-LALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
2e09B           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESNGFKLREAFWIVKAFRRH
2dzuA           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
2dzwA           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
3b4uA           ---------------------------------------------------------------------A
1a53A           IIAEYKRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSIPILMKDFIVKESQIDDAYNLGADT
3daqA           -----------------------------------------------------------------HLFEG
2dzuB           ------YLTAGDPDKQSTLNFL-LALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
1dwxA           ---HKATSDSCLGSIMNPKSLTRGPRDKPTPELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETT
2dzvB           -KDGSLYLTAGDPDKQSTLNFLL-ALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
1ak5A           VDSQKRYLVGAGINTRDFRERVPALVEAGADVLCIDSSDG---------------FSEWQKITIGWIREK
2dzxA           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADSHYRALKNGFKLREAFWIVKEFRRH
2dzsB           -KDGSLIPYLTAGDPDQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESNGFKLREAFWIVKEFRRH
2a7rB           LEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGY-----------------SEHFVEFVKDVRKR
3di1A           -----------------------------------------------------------------HLFEG
3denA           ---------------------------------------------------------------FTGSIVA
2a6nA           ---------------------------------------------------------------FTGSIVA
3c56B           --KEGYGVGAFNFVNFEMLNAIFEAGN--------EENSP-LFIQASEGAIKYMGIDMAVGMVKIMCERY
3bggA           KTHVDILNDFTLDVMKELITLAKCHEFKFADIGNTVKKQYEGGIFKIASWADLVNAHVGSGVVKGLQEVG
2dztB           YRKNGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVAGILVVDLPVFHAKEFTE
2ehhC           --------------------------------------------------------------------QG
3eahA           QAQQDGPCTPRRCLGSLVEQLLSQARDFIYSSIKRSGSQAHEQRL-QEVEAEVAATGTYQLRESELVFGA
2dzvA           YRKNGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKAGVDGILVVDLPVFHAKEFTEI
2aqwA           NSNIPTLDKINDIGNTVKNYRKFIFEYLKSDSCTINVYGTN--------------LKDICFDYEKNKYYS
1ea0A           CRELEIKVAQGAKPGEGGQLPGFKVTEMIARLRHSTPGVMLISPPPHHDI---YSIEDLAQLIYDLKQIN
2dzaB           --------------PDSALERAREMVAEGADILDLGAESTRPPVPVEEEKRRLLPVLEAVLSLGVPVSVD
3barA           ----DMKINDIGNTVKNYRKFI--FEYLKSDSCTVNIYMGTNMLKDICYDEEKNKYYSAFVLVKTTNPDS
2ehhA           ------------------------------------------------------------------MFQG
3dqsA           ----PKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLSARDFINQYYSSIKRSGSQAHEAEVASTYHL
1dvjC           ----RLILAMDLMNRDDAL---RVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKIPETNEKICRATFKA
1ad1B           ----------------------------------------------------------------------
1dwxB           -----------------------YGSFKEAKIEEHLARLEAVTKEIETTGTYQLT----LDELIFATKMA
3eb2A           -----------------------------------------------------------------GVFPY
3dz1A           ---------------------------------------------------------------AAGTFAI
2dqwB           ------------TPPERALERAREMVAEGADILDLGAESPV---------------EEEKRRLLPVLEAV
3dfyB           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGE----------------NLKEDIEAVEEIAKV
1dkwA           --------WYYGETNEIVADKVAAAVASGF----MVIACIGETLQERESGRTA----VVVLTQIAAIAKK
3dfyL           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGE----------------NLKEDIEAVEEIAKV
3eisA           --------------------------------------------------------PPAAGLVPADGARL
3dfyF           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGE----------------NLKEDIEAVEEIAKV
3e68B           -----------------------------YYGSFKEAKIEEHLA---RLEAVT-KEIETTGTYQLTLDEL
1dvjA           ---NRLILAMDLMNRDDAL---RVTGEVREYIDTVKIGYPLVLSEGMDIDFKVADIPETNEKICRATFKA
1efzA           ---------------------IEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSR
3dqtB           ---GSLVLPRPPPAEQLLSQARDFINQYYSSIKRSGSQAHEERL-------------QEVEAEVASTGTY
3cb3C           -------------PIDQLMVNASASIERGIGGIKLKVGQP---------------DGALDIARVTAVRKH
3e7gC           --------------------LTRGPRDKPTPPDELL-PQAIEFVNQYYGSFKEAKIEERVEAVTKEIETT
3dfyE           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGE----------------NLKEDIEAVEEIAKV
3eb2B           -----------------------------------------------------------------GVFPY
3dfyH           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGE----------------NLKEDIEAVEEIAKV
3dfyN           RDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVG----------------ENLKEDIEAVEEIAKV
3eegA           --------------DQAFLARVEAVIEAGADVVNIPDTT--------------GYLPWQYGERIKYLDNV
3bi8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
3c52B           HNAGVSVEAELGRLMGI-LVNPKEAEQFVKESQVDYLAPAIGTSH----GAFKFKGEPKLDFERLQEVK-
1bkhA           LGDSASVRVDVNQYW--DESQAIRACQVLGDNGIDLIEQPISRIN----------------RGGQVRLNQ
1amkA           AWNQVVLAYEPVWAIGTGKVA----------TPEQAQEVHLLLRKWENIGTDVAAKLR------------
1djqA           VGSDCAIATRFGVDTQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVK
1bkhB           LGDSASVRVDVNQYW--DESQAIRACQVLGDNGIDLIEQPISRINRGGQ----------------VRLNQ
3dfhA           YGNQFHILHDVHERL--FPNQAIQFAKEVEQYKPYFIEDILPPNQTEWL----------------DNIRS
1djnA           VGSDCAIATRFGVDTQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVK
3dipB           ---RIEIMCELHSLWG-----------------THAAARICNALADYGVLWVEDPIAKMDNIPAVADLRR
3dwjA           KMAHRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSD--GKHDFR
2dw6A           AQLAVDANGRF------NLETGIAYAKMLRDYPL---------FWYEEVGDPLD-------YALQAALAE
3e5bD           WFAPIVADAEAGFGGPLDAFEIMKAY---IEAGAAGVHFEDQ--------LASGGKVLIPTAAHIRNLNA
3egbB           QITQSTISRFACRIVCDRNE--PYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRQ
1chrA           LGSKAYLRVDVNQA--WDEQVASVYIPELEALGVELIEQP----------------VGRENTQALRRLSD
3eahB           KQNAPRCVGRIQWGKLQVFDARDCRS-AQEMFTYICNHIKYATNRGNLRSAITVFP----QRCPGRGDFR
3dipA           VGQRIEIMCELHSLWG-----------------THAAARICNALADYGVLWVEDPIAKMDNIPAVADLRR
2bahA           IKLKIKPGWDVQPVR-ATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLYIEQPLAWDDLVDHAELAR
3e5bB           WFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQLASGKVLIPTAAHIR------NLNAARLAA-
2dw7A           IGKDAQLAVDANGRF--NLETGIAYAKMLRDYPLFWYEEVGDPLD----------------YALQAALAE
3bsmA           --FGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREH---------------
3c6eA           SCVTTMAKNKPTLDFEL-IKTEAKQPATLRKYCIEAKLTNTTESRCPTQGEPSLNEEQDKRFVCKHSMVD
3c4uA           HNAGVSVEAELGRVLVNPKEAEQF----VKESQVDYLAPAIGTSHGAFKFKG----EPKLDFERLQEVKR
1bwkA           IGPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVY
3e7mA           WRNAPRCIGRIQWSNLQVFDARNCST----AQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKH--DF
3dwjB           HRNAPRCIGRIQWSNLQVFDARNCST---AQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHD---F
1b9bA           LDKEEAKRVVIAYEPVWAIG----TGRVATPQQAQEVHAFIRKLLSEMYDEETAGS--------------
3b8iA           PALTIIARTNAELIDVDAVI---QRTLAYQEAGADGICLV-----------------GVRDFAHLEAIAE
3b8iB           PALTIIARTNAELIDVD--AVIQR-TLAYQEAGADGICLV-----------------GVRDFAHLEAIAE
3ct2A           LGDSASVRVDVNQAW--DEAVALRACRILGGNGIDLIEQPISRNNRAGM----------------VRLNA
1bwlA           GHEKVGLRLSPYGVFNSMSAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYGGSNDFVYS
3bjsA           LGDEVDILTDANTAY--TMADARRVLPVLAEIQAG--WLEEPF--------------ACNDFASYREVAK
2dp3A           ESKMLWKEVVIAYEPVWSI------GTGVVATPEQAEEVHVGLRKWEKVAAEGAQHIR------------
1dtnA           VGDDFGIMVDYNQS--LDVPAAIKRSQALQQEGVTWIEEPTLQHD----------------YEGHQRIQS
1df1A           WRNAPRCIGRIQWSNLQVFDARNCST---AQEMFQHICRHILYATNNGNIRSAITVFPQ--RSDGKHDFR
1d3hA           HRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETKPLRDLSTQTIREMYA
3c5xA           SCVTTMAKNKPTLDFELIKTEAK-QPATLRKYCIEAKLTNTTESRCPTQGEPSLNEEQDKRFVCKHSMVD
1d3gA           HRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLRDLSTQTIREMYA
3b8iD           VDPALTIIARTNAELIDVDAVIQR-TLAYQEAGADGICLV-----------------GVRDFAHLEAIAE
2a4aB           TNKILKVIIEVGEL--KTEDLIIKTTLAVLNGNADFIKTSTGKVQ-INATPSSVEYIIKAIKEYIKNNPE
3dg3A           FGDAIELYVDGNRGW--SAAESLRAMREMADLDLLFAEEL----------------CPADDVLSRRRLVG
1bkhC           LGDSASVRVDVNQYW--DESQAIRACQVLGDNGIDLIEQPISRIN----------------RGGQVRLNQ
3bjsB           LGDEVDILTDANTA--YTMADARRVLPVLAEIQAG--WLEEPF--------------ACNDFASYREVAK
2an2A           WRNSNRCIGRLFWNSLNVIDRRDVRTKEVRDALFHHIETATNNGKIRPSITIFPPEEKGE--KQVEIWNH
2e77C           SGLPVFVKGIQHPED----------ADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERV------
3cb3B           LGDAVPLMVDANQQW--DRPTAQRMCRIFEPFNLVWIEEP----------------LDAYDHEGHAALAL
3ddmA           LGAATPLMADANQ--GWDLPRARQMAQRLGPAQLDWLEEPLRADRPAAEWAELAQAAP------------
1dbtA           TSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLD--GVVCS--------VHEAKAIYQAVSPSFLTVTP
1dkwB           LKKADWAKVVIAYEPVWAIGTGKV----ATPQQAQEAHALIRSWVSSKIGADVAGELR------------
2abbA           WSADRIGIRVSPIGTFQNVDNGPN---EEADALYLIEELAKRGIAYLHMSETDLAGGKPYSEAFRQKVRE
2e68B           YGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESELGGKYILPTALANVNAFYR
2a7rC           FPQHTIMAGNVVTGEM---------VEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3bpwB           AIFQKNLSLDNKQAYVIMAQEAL-------NMSSYLNLEQNNEFIGFVVGANSYDEMNYIRTYFPNCYIL
2a4aA           TNKILKVIIEVGELKTE--DLIIKTTLAVLNGNADFIKTSTGKVQ-INATPSSVEYIIKAIKEYIKNNPE
1dbtB           STSEQIMKDELLIE--KSLIDTVVHYSKQAEESGLDGVVC---------SVHEAKAIYQAVSPSFLTVTP
1eepA           PNLDLIAGNIVTKEAALDL----------ISVGADCLKVGIGPGSICTTRIVAGVGVPQITAICDVYEAC
2bznB           FPQHTIMAGNVVTGEMVEE---------LILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3b8iE           VDPALTIIARTNAELIDVDAVIQR-TLAYQEAGADGICLV-----------------GVRDFAHLEAIAE
2djxA           YGLPFGVKMPPYFDIAHFDTAAAVLNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYR
1al7A           LSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEHGAAGIIVSNHGARQLDYVPATIMALEEVVKA
2cu0A           VDADFIVGNIANPKAVD------------DLTFADAVKVGIGPGSICTTRIVAGVGVPQITAVAMVADRA
2a1yA           LPESFVIAGNVGT---------PEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAK
2b4gB           YGLPFGVKMPPYFDIAHFDMAAAVLNDFPLVKFIDPANETVVIKPKQGFGGLGGKYVLPTALANVNAFFR
2e77B           SGLPVFVKGIQHPEDADMAI----------KRGASGIWVSNHGARQLYEAPGSFDTLPAIAERV------
3e65B           WRNAPRCIGRIQWSNLQVFDARNCST---AQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLW
1eepB           PNLDLIAGNIVTKEAAL----------DLISVGADCLKVGIGPGSICTTRIVAGVGVPQITAICDVYEAC
2dzwB           ---AREEGIKTVFLAAPNTPD--ERLKVIDDMTTGFVYLVSL--------YGTTEEIPKTAYDLLRRAKR
3cb3A           LGDAVPLMVDANQQW--DRPTAQRMCRIFEPFN-LVWI---------------EEPLDAYDHEGHAALAL
2b4gA           YGLPFGVKMPPYFDIAHFDMAAAVLNDFPLVKFITCVNETVVIKPKQGFGGLGGKYVLPTALANVNAFFR
3e7sA           KRNAPRCVGRIQWGKLQVFDARDCSS---AQEMFTYICNHIKYATNRGNLRSAITVFPQ--RAPGRGDFR
1eb3A           PELYIICDVCLCEYTSHGHCGVLYDDGTINRE--------------------------------------
3e49A           T--DAVINLTTGGSPHTVEERLRPAT--HYPELASLNGSNFG--------LYPLERFKEFAHGWEREHLE
1al8A           SLSWKDVAWLQTITSLPILVKGVITAEDAVQHGAAGIIVSNHGAR-------QLDYVPATIMALEEVVKA
2a7nA           KMDKANLEMQAALMSRQMDSFNWEALRWLRDLWPHKLLVKCIAEGADGVIGGRQLDCAISPMEVLAQSVA
2bznC           FPQHTIMAGNVVTGEMVE---------ELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3c52A           GVSVEAELGRLMGIVLVNPKEAEQF---VKESQVDYLAPAIGTSHGAFKFK----GEPKLDFERLQEVK-
1b3oA           PNLQVIGGNVVTAAQAKNLID----------AGVDALRVGMGSRPQAT------------AVYKVSEYAR
2du2A           SGLPVFVKGIQHPED----------ADMAIKRGASGIWVSNHGAR-QLYEAPGSFDTLPAIAERVN----
2dzsA           SSTPIVLMTYYNPIYRAGV---RNFLAAAKASGVDGILVVDLPVFHAKEFTEIAREEPKTAYDLLRRAKR
2dzxB           IARAAGIKTVFLAAPNTPDERLKV----IDDMTTGFVYLVSL--------YGTTEEIPKTAYDLLRRAKR
3e7gA           GTYQLTGDELIFATKQAWRNAPRCIGRIQWSNARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRS
2cffA           REIDVEPVFSLVTRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAI
2e77A           SGLPVFVKGIQHPEDADMAIK-----------------RGASGIWVSNHGARQLYEAPGSFDTLPAIAER
3ceuB           FNLGIHLNAR----------NPSEPHDYAGHVSCSCHSVEEVKNRKHFYDYVFSPIYSTYTAEELREAQK
2bleA           FPEHTIMAGNVVTGEM---------VEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSA
2bznA           FPQHTIMAGNVVTGEM---------VEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3b8iC           DPALTIIARTNA-ELIDVDAVIQR-TLAYQEAGADGICLV-----------------GVRDFAHLEAIAE
2a7rD           FPQHTIMAGNVVTGEMVEE---------LILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
2a7rA           FPQHTIMAGNVVTGEM---------VEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
2csbA           EEDVPAIEVRAVKRNPLQPALYR-ILVRYGRVDLPVTVDEVPPEAGEFERLIERYDVPIDEKE-------
2bznD           FPQHTIMAGNVVTGEMVEE---------LILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
2dztA           SSTPIVLMTYYNPIYRAGV---RNFLAEAKASGVAGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPRAK
2c6qG           FPQHTIMAGNVVTGEMVEE---------LILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
2agkA           QDGRWIVAMNKWQTLTD--LELNADTFRELRKYTNEFLIH-------------AGGIDELLVSKLFEWTK
3c3nA           YGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLPKQGFGGLGGKYILPTALANVNAFYR
1b3oB           IKYIKDKYPNLQVIGGNVVTA--AQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYA
2bwgB           FPEHTIMAGNVVTG---------EMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSA
2bwgA           FPEHTIMAGNVVT---------GEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSA
3dgbA           LGDSASVRVDVNQA--WDEAVALRACRILGGNGIDLIEQPISRNN----------------RAGMVRLNA
2djlA           YGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCESESVVIKPKQGFGGLGGKYILPTALANVNAFYR
3dg6A           FGDAIELYVDGNRGW--SAAESLRAMREMADLDLLFAEELCPADDVLSR----------------RRLVG
2btmA           LTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCG----HIRSVVSRLFGPEAAEAIR------------
1btmA           QVKQAV----IAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSR---------------------LFGPEA
1dd7A           WRAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNRSAITVFPQRSDGKHDFRLWN----
2e68A           YGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDGFGGLGGKYILPTALANVNAFYR
3dfyA           ---KYIVDANMGYTQKEAVEFARAVY----QKGIDIAVYEQPV--------------RREDIEGLKFVRF
3di0A           VGVALTTPFTNNKVNIEALKTH---VNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVD----
3di0B           VGVALTTPFTNNKVNIEALKTH---VNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVD----
3c61A           YPHSFGVKMPPYFDFAHFDAAATCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANVNAFYR
2c6qA           FPQHTIMAGNVVTGEMVEE---------LILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
2c6qB           FPQHTIMAGNVVTGE----MVEEL-----ILSGADIIKVGIGPGSCTTRKKTGVGYPQLSAVMECADAAH
3cjpA           IVNNKLVGIGELTPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPL------------VLQDIKEIAELCK
2cu0B           VDADFIVGNIANPKAVD------------DLTFADAVKVGIGPGSICTTRIVAGVGVPQITAVAMVADRA
3e7sB           WRNAPRCVGRIQWGKLQVFDARDCSS---AQEMFTYICNHIKYATNRGNLRSAITVFPQ--RAPGRGDFR
2c18B           ALDPFTTHGQDGILDDDGYVLNDV----SIDVLVRQALSHAEAGAQVVAPSDMMDGRIG-----------
3di1B           VGVALTTPFTNNKVNIEALKTH---VNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVD----
1dqwA           LLMLAELSCKGSLSTGEYTKG--------------TVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTP
2bwgD           FPEHTIMAGNVVTGEMV---------EELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSA
3c0jA           IVTPMDEKGNVC------RASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLAD----
2a6lA           IVTPMDEKGNVC------RASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLAD----
2dzpB           SSTPIVLMTYYNPIYRAGVRNAKEFTEIAREEGIKTVFLMTTGFVYLVSLYGTTEEIPKTAYDLLRRAKR
3eb2D           LVSPVDAEGRVRAD------VMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATIEAAQ----
2e09A           SSTPIVLMTYYNPIYRAGVRVDGILVVDLPVFHAKEFTEIAREEGIKTVSLYGTEEIPKTAYDLLRRAKR
2c3zA           GADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRIGANSRDLETLEINKENQRKLISM
3b5vA           AILTEAELESLLAYARSYGMEPLIKINDENDL----DIALRIGARFIGIVSADWETLAINKANQAKLISM
2dzpA           SSTPIVLMTYYNPIYRAGVFHAKEFTEIAREEGIKTVFLDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKR
2e09B           SSTPIVLMTYYNPIYRAGVRNFLAEAKASGVAAPNTPDERLKVIDDMTTGYGTTEEIPKTAYDLLRRAKR
2dzuA           SSTPIVLMTYYNPIYRAGVRNFLFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKR
2dzwA           SSTPIVLMTYYNPIYRAGVRNFVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKR
3b4uA           LTTPFKTDGTVDID------AMIAHARRCLSNGCDSVTLFGTTGEGCSVGSRER------QAILSSFIAA
1a53A           VLLIVKILTERELESLLEYARSYGMEPIEINDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISM
3daqA           VGVALTTPFTNNKVNLEALKAH---VNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVIDLVD----
2dzuB           SSTPIVLMTYYNPIYRAGVFHAKEFTEIAREEGIKTVFLMTTGFVYLVSLYGTTEEIPKTAYDLLRRAKR
1dwxA           GTYQLTLDELIFATKRIQWSNLQVFDARNCSQEMFQHICRHILYATNNGNIRSAITVFPQRSD-GKHDFR
2dzvB           SSTPIVLMTYYNPIYRAGVRNFKEFTEIAREEGIKTVFERLKVIVYLVSLYGTTEEIPKTAYDLLRRAKR
1ak5A           YGDKVKVGAGNIVDGEG--------FRYLADAGADFIKIGIGRGQATA-------VIDVVAERNKYFEET
2dzxA           SSTPIVLMTYYNPIYRAGV---RNFLAEAKASGVDGILVVDLPVFHAKEFTEIARAAPKTAYDLLRRAKR
2dzsB           SSTPIVLMTYYNPIYRAGVRNFFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEIPKTAYDLLRRAKR
2a7rB           FPQHTIMAGNVVTGEM---------VEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3di1A           VGVALTTPFTNNKVNIEALKTH---VNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVD----
3denA           IVTPMDEKGNVC------RASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHAD------VVMMTLDL
2a6nA           IVTPMDEKGNVC------RASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLAD----
3c56B           PHIPVALHLDHGTTFESCEKAVK--------AGFTSVMIDASHHAF-----EENLELTSKVVKMAHNAGV
3bggA           LPLHRGCLLIAEMSSTGSLATGDY-----TRAAVRMAEEHSEFVVG-----FISGSRVSMKPEFLHLTPG
2dztB           IAREEGIKTVFLAAPNTPDERLKVID----DMTTGFVYLVSL--------YGTTEEIPKTAYDLLRRAKR
2ehhC           SIVALITPFKEGEVDYEALGNL---IEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAA----
3eahA           KQNAPRCVGRIQWGKLQVFDARDCRS----AQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRI
2dzvA           AR-EEGIKTVFLAAPNTPAERLKVIDDMTTGFVYLVSLYG-------------TEEIPKTAYDLLRRAKR
2aqwA           AYVLIKTTNKDSFIFQNELSINDKQAYIVADETQKATLKIEQNNEFIGFVVGSNAFEEKIIRNKFPDSYI
1ea0A           PDAKVTVKLVSRSGIGTIAAGVAKANADIILISGNSGGTGASPQT-------------------------
2dzaB           TRKPEVAEEAL-------KLGAHLLNDVTGLRDERMVALAARHGV--------AAVVMHMPVPDPATMMA
3barA           AIFQKNLSLDNKQA-------YVIMAQEALNMSSYLNLEQNNEFIGFVVGANSYDEMNYIRTYFPNCYIL
2ehhA           SIVALITPFKEGEVDYEALGNL---IEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAA----
3dqsA           RESELVFGAKQAWCVGRIQWGKLQVFDARSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPG-RGDFR
1dvjC           GADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMVGPSTRPERLSRLRE
1ad1B           TKTKIMGILNVTPNVESAVTRVKA----MMDEGADIIDVGGVSTMITV---------EEELNRVLPVVEA
1dwxB           WRNAPRCIGRIQWSNLQVFDARNCST----AQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKH-DFR
3eb2A           LVSPVDAEGRVRAD------VMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVR------ATIEA
3dz1A           APTPFHDDGKID------DVSIDRLTDFYAEVGCEGVTVLGILGEAPKLDAAEAEAVATRFIKRAK----
2dqwB           LSLGVPVSVDTRKPEVEALKLGAHLLNDV-TGLRDERMVALAARH-------------------------
3dfyB           TR---GAKYIVDANMGYTQKEAVEFARAVYQKGIDIAVYEQP--------------VRREDIEGLKFVRF
1dkwA           LKKADWAKVVIAYEP-VWAIGTGK---VATPQQAQEAHALIRSWVSSKIGADVAGELR------------
3dfyL           TGAKYIVDANMGYTQKEAV----EFARAVYQKGIDIAVYEQP--------------VRREDIEGLKFVRF
3eisA           YPDLPFIASGLGLEGYDAIESVVDHARRLQKQGAAVVSLMGTSLSFYRGAAFN--------AALTVAMRE
3dfyF           TGAKYIVDANMGYTQKEAVE----FARAVYQKGIDIAVYEQP--------------VRREDIEGLKFVRF
3e68B           IATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDF
1dvjA           GADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEVKNYVGPSTRPERLSRLRE
1efzA           KEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAV----------GEGQDEMFRVLDFSVP
3dqtB           RESELVFGAKQAWRGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGDF
3cb3C           LGDAVPLMVDANQQW--DRPTAQRMCRIFEPFNL---------VWIEEPLDAYD-------HEGHAALAL
3e7gC           GTYQLTGDELIFATKRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDF
3dfyE           TGAKYIVDANMGYT----QKEAVEFARAVYQKGIDIAVYEQP--------------VRREDIEGLKFVRF
3eb2B           LVSPVDAEGRVR------ADVMGRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQ------REAVVRATIEA
3dfyH           TGAKYIVDANMGYTQKEAVEFARAV----YQKGIDIAVYEQP--------------VRREDIEGLKFVRF
3dfyN           TGAKYIVDANMGYTQKEAVEFARAV----YQKGIDIAVYEQP--------------VRREDIEGLKFVRF
3eegA           SNIDKAILSAHCHN--DLGLATANSLAAL-QNGARQVECTING--IGERAGNTA-------LEEVVAECH
3bi8A           --AIITPFTNTGVDFDKLSELIEWHI----KSKTDAIIVCGTTGEATTMTETERKET------IKFVIDK


                         .         .         .         +         .         .         .:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
3c52B           RLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTD----TDLRIAFIAEV
1bkhA           RTP-APIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQIAEAAGIGTMLEGSIGTLASAHA
1amkA           -------ILYGGSVNAANAATLYAKINGFLVGGASLKPEFR-----------------------------
1djqA           QVSKKPVLGVGRYTDPEKMIEIVTKADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGC-----------
1bkhB           RTP-APIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQAGIGLYGGTMLEGSIGTLASAHA
3dfhA           QSS-VSLGLGELFNNPEEWKSLIANIDFIRCHVSQIGGITPALKLGHLCQNFGVRIAWHCPPDMTPIGAA
1djnA           QVSKKPVLGVGRYTDPEKMIEIVTYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVCISRWEIGG
3dipB           QTR-APICGGENLAGTRRFHEMLCAIDFVMLDLTWCGGLSEGRKIAALAETHARPLAPHTGPVALMAGLH
3dwjA           LW-NSQLIRYAGYQMPDGTIRGDATLEFTQLCIDLGWKPRYGRFDVLPLVLQADGQ--DPEVFEIPPDLV
2dw6A           FY-PGPMATGENLFSHQDARNLLRYGDWLQFDCALSYGLCEYQRTLEVLHGWSPSRCIPHGGHQMSLNIA
3e5bD           ARLAA-DVMGTPTLIVARTAEAAKLLTSDIDERDQPFVDYEAGRTAEGFYQVKNGIEAIAYAPYCDLIWM
3egbB           PGVWREISVCGDVYTLRKLVESETNVLQDGSLIDLCGATLLWRTADGLFHT-----PTQKH-IEALR---
1chrA           NNR-VAIMADESLSTLASAFDLARDVDVFSLKLCNMGGVSATQKIAA--VAEASGIASYSTIGTSVALQL
3eahB           IWN-SQLVRYAGY-RQQDGSVRGDPVEITELCIQHGWTPGNGRFDVL-----------------------
3dipA           QTR-APICGGENLAGTRRFHEMLCAIDFVMLDLTWCGGLSEGRKIAA--LAETHARPLAHTGPVALMAHA
2bahA           RIR-TPLCLDESVASASDARKALALGGVINLKVARVGGHAESRRVHDFGAPVWCGGMLESGIGRAHNIHL
3e5bB           DVMGTPTLIVARTDAEAAKLLTSDIDDQPFVDYEAGRTAEGFYQVKN---GIEPCIARAIAYAPYCDLIW
2dw7A           FYP-GPMATGENLFSHQDARNLLRYRDWLQFDCALSYGLCEYQRTLEVLHGWSPSRCIPHGGHQMSLNIA
3bsmA           --TTTPLAIGEVFNSIHDCRELIQNIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLG
3c6eA           RGWGNGLFGKGGIVTCAMFRCKKNMGKVVQPENLEYTIVITPHSGEEHAGKHGKEI--KITPQSSITEAE
3c4uA           -LTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVA
1bwkA           SIWKGPVIRAGNFALHPEVVREEVKRTLIGYGRFFISNPDLVDRLEKGLPLDRDTFYQMSAHGYIDYPTY
3e7mA           RLWNSQLIRYAGYQMPDGTIRGDAALEFTQLCIDLGWKPRYGRFDVLPLVLQADGQ-------DPEVFEI
3dwjB           RLWNSQLIRYAGYQM-PDGTIRGDALEFTQLCIDLGWKPR-------YGRFDVLPLVLQADGQDPEVFEI
1b9bA           ----IRILYGGSIKPDNFLGLIVQKIDGGLVGGASLKESFI-----------------------------
3b8iA           HLHIPLMLVTYGNPQLRDDARLARLVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEYQ
3b8iB           HLHIPLMLVTYGNPQLRDDARLARLVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYT------
3ct2A           SSP-APIMADESIECVEDAFNLAREASVFALKIAKNGGPRATLRTAAGTMLEGGIGTLASAHAFLTLNKL
1bwlA           IWK-GPVIRAGNFALHPEVVREEVKRTLIGYGRFFISNPDLVDRLEKGLPLN------------------
3bjsA           ITPLVPIAAGENHYTRFEFGQMLDAVQVWQPDLSKCGGITEGIRIAAMASAYRIPINAHTGLNHAATIHF
2dp3A           ------IIYGGSANGSNCEKLGQCPIDGFLVGGASL-KPEFMTMIDILT---------------------
1dtnA           KLNV-PVQMGENWLGPEEMFKALSICRLAMPDAMKIGGVTGWIRASA--LAQQFGIPMSSHLFQEISAHL
1df1A           LWN-SQLIRYAGYQMPDTIRGDAATLEFTQLCIDLGWKPRYGRFDVLPLVLQADGQDEVFEIPPDLVLEV
1d3hA           LTQGRVPIIGGGVSSGQDALEKIRAASLVQLYTALFWGPPVVGKVKREL---------------------
3c5xA           RGWGNGLFGKGGIVTCAMFRCKKNMGKVVQPENLEYTIVITPHSGEEHGKHGKEIKITSSITEAELTGYG
1d3gA           LTGRVPIIGVGGVSSGQDALEKIRAASLVQLYTALFWGPPVVGKVKREL---------------------
3b8iD           HLHIPLMLVTYGNPQLRDDARLARLVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEY-
2a4aB           KNNKIGLKVSGGISDLNTASHYILLRFLFRIGSSS-----------------------------------
3dg3A           QLD-MPFIADESVPTPADVTREVLGATAISIKTARTGFTGSTRVHHLAEGLGLDMVMGNQQIGTACTVSF
1bkhC           RTP-APIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQIAIGLYGGTMLEGSIGTLASAHA
3bjsB           ITPLVPIAAGENHYTRFEFGQMLDAVQVWQPDLSKCGGITEGIRIAA--MASAYRIPINAGLNHAATIHF
2an2A           QLIRYAGYEGEAIGDPASCSLTAAQLGWRGERTDFDLLPLIFRMKGDEQPVWYHPDISDLELKWYGVPII
2e77C           -NKRVPIVFDSGVRRGEHVAKALASADVVALGRPVLFGLALGGWQGAYSVLD--------YFQKDLTRVM
3cb3B           QFD-TPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIAS--LAEHAGLMLAP----HFAMEL
3ddmA           ----MPLAGGENIAGVAAFETALAALRVMQPDLAKWGGFSGCLPVARAVVAAGLRYLQASAHLLAAVPGL
1dbtA           GIR-MSEDAANDQVRVATPAIAREKSSAIVVGRSITKAEDPVKAYKA-----------------------
1dkwB           ------ILYGGSVNGKNARTLYQQRVNGFLVGLKP-----------------------------------
2abbA           RFH-GVIIGAGAYTAEKAEDLIGKGIDAVAFGRDYIANPDLVARLQKKAELN------------------
2e68B           RCPDKLVFGCGGVYSGEDAFLHILAASMVQVGTALQEEGPGIFT--------------------------
2a7rC           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYGK
3bpwB           SPG--IGAQNGDLHKTLTNGYHKSYEILINIGRAITKNPYPQKAAQM-----------------------
2a4aA           KNNKIGLKVSGGISDLNTASHYILLRRFLSDNFRIG-SSSLVIKLRK-----------------------
1dbtB           GIR-MSEDAANDQVRVATPAIAREKSSAIVVGRSITKAEDPVKAYKA-----------------------
1eepA           NNTNICIIADGGIRFSGDVVKAIAAADSVMIGNLFAGTKESPSEEIIYNGKKFKSMVPYSGKLKDILTQL
2bznB           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAS
3b8iE           HLHIPLMLVTYGNPQLRDDARLARLVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEYQ
2djxA           RCPDKLVFGCGGVYSGEDAFLHILAASMVQVGTALQEEGPGIFT--------------------------
1al7A           AQGRIPVFLDGGVRRGTDVFKALALAAGVFIGRPVVFSLAAEGEAGVKKV--------------------
2cu0A           QEYGLYVIADGGIRYSGDIVKAIAAADAVMLGNLLAGTKEAPGKEVIINGRKYKQYRMKYMKTRKFVPEG
2a1yA           AAS-KPIIADGGIRTNGDVAKSIRFATMVMIGSLFAGHEESPGETIEKLYKEYFGSFVEHKGLEDTLIEM
2b4gB           RCPDKLVFGCGGVYSGEEAFLHILAASMVQVGTALHDEGPIIFARLNKE---------------------
2e77B           -NKRVPIVFDSGVRRGEHVAKALASADVVALGRPVLFGLALGGWQGAYSVLD--------YFQKDLTRVM
3e65B           NSQ---LIRYAGYQM-PDGTIRGDTLEFTQLCIDLGWKPRYGRFDVLP----------LVLQADGQDPEI
1eepB           NNTNICIIADGGIRFSGDVVKAIAAADSVMIGNLFAGTKESPSEEIIYNYGMVPYSGKLKDILTQLKGGL
2dzwB           IC-RNKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGREATEF---------------------
3cb3A           QFD-TPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIAS--LAEHAGLMLAHFAMELHV---
2b4gA           RCPDKLVFGCGGVYSGEEAFLHILAASMVQVGTALHDEGPIIFA--------------------------
3e7sA           IW-NSQLVRYAGY-RQQDGSVRGDNVEITELCIQHGWTPGNGRF--------------------------
1eb3A           ----------------------------------------------------------------------
3e49A           RSRDL-VFKNTFADIEFILKTCGG--NGTRFEFECYDTSHLYNLAHFVDRKLATPPFFVQTVFGLLGGIG
1al8A           AQGRIPVFLDGGVRRGTDVFKALALAAGVFIGRPVVFSLAAEGEAGVKKVLQ------------------
2a7nA           KT-GKPVLIDSGFRRGSDIAEAVLLGRATLYGLAARGETGVDEVLT------------------------
2bznC           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAS
3c52A           RLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVA
1b3oA           R-FGVPVIADGGIQNVGHIAKALALASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDI---
2du2A           --KRVPIVFDSGVRRGEHVAKALASADVVALGRPVLFGLALGGW--------------------------
2dzsA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2dzxB           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
3e7gA           DGKHDQLIRYAGYQM-PDGSIRGDPVEFTQLCIDLGWKPKYGRFDVVPL---------------------
2cffA           EAEVK-VLAAGGISSENSLKTAQKVLKGVIVGRAFLEGILTVEVMKR-----------------------
2e77A           VNKRVPIVFDSGVRRGEHVAKALASADVVALGRPVLFGLALGGW--------------------------
3ceuB           AKIIDSKVALGGINEDNLLEIKDFGFGGAVVLGDLWNKFDACLDQNY-----------------------
2bleA           HGLKGHIISDGGCTCPGDVAKAFGAADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHGVAEYR
2bznA           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDYKLFYGMSSEMAMKKYASEGK
3b8iC           HLHIPLMLVTYGNPQLRDDARLARLVNGHAAYFAAIKATYDCLRRGALTASELSKKYTFPEEYQAWARD-
2a7rD           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDG--------KKYKLFYGKTVE
2a7rA           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAV
2csbA           ----------------------------------------------------------------------
2bznD           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDYKLFYGMSSEMAMKKYASEGK
2dztA           RICRNKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2c6qG           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAS
2agkA           DYDDLKIVYAGGAKSVDDLKLVDELKVDLTFGSSLDIFGGNLVKFED-----------------------
3c3nA           RCPDKLVFGCGGVYSGEDAFLHILAASMVQVGTALQEEGPGIFT--------------------------
1b3oB           RRFGVPVIADGGIQNVGHIAKALALASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIGAK
2bwgB           HGLKGHIISDGGCTCPGDVAKAFGAADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHVAEYRA
2bwgA           HGLKGHIISDGGCTCPGDVAKAFGAADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHGV
3dgbA           SSP-APIMADESIECVEDAFNLAREASVFALKIAKNGGPRATLRTAAGTMLEGGIGTLASAHAFLTLNKL
2djlA           RCPDKLVFGCGGVYSGEDAFLHILGASMVQVGTALQEEGPGIFT--------------------------
3dg6A           QLD-MPFIADESVPTPADVTREVLGATAISIKTARTGFTGSTRVHHLAEGLGLDMVMGNQQIGTACTVSF
2btmA           ------IQYGGSVKPDNIRDFLAQQIDGALVGGASLEPASFLQLVE------------------------
1btmA           -AEAIRIQYGGSVKPDNIRDFLAQQIDGPLVGGASLEPASFLQLVE------------------------
1dd7A           ----SQLIRYAGYQTIRGDAATLETQLCIDLGWKPRYGRFDVLPLVLQADG--QDPEVFEIPPDLVLEVT
2e68A           RCPDKLVFGCGGVYSGEDAFLHILGASMVQVGTALEEGPGIFTRL-------------------------
3dfyA           HSP-FPVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVEIAESSGLKL---------------
3di0A           --KRVPVIAGTGTNDTEKSIQASIQADAIMLITPYYNKTNQRGLVK---HFEAIADAVKLPVVLYNVPSR
3di0B           --KRVPVIAGTGTNDTEKSIQASIQADAIMLITPYYNKTNQRGLVK--HFEAIAD-AVKLPVVLYNVPSR
3c61A           RCPGKLIFGCGGVYTGEDAFLHVLAASMVQVGTALHEEGPAIFE--------------------------
2c6qA           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG
2c6qB           GLK-GHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG
3cjpA           AFPKVPVILGMGGSNWMTAVELAKEIQNLYLDTSAYFSTFVLKIVLKCIFGTDMPFGDLQLSIEAIKKMS
2cu0B           QEYGLYVIADGGIRYSGDIVKAIAAADAVMLGNLLAGTKEAPGKEVIINGRKYKQYRMKYMKTRKFVPEG
3e7sB           IWN-SQLVRYAGYR-QQDGSVRGDNVEITELCIQHGWTPGN-----------------------------
2c18B           ----------------------------------------------------------------------
3di1B           --KRVPVIAGTGTNDTEKSIQASIQADAIMLITPYYNKTNQRGLVK---HFEAIADAVKLPVVLYNVPSR
1dqwA           GVG-LDDKGDALGQQYRTVDDVVSTSDIIIVGRGLFAKGRDAKVEGE-----------------------
2bwgD           HGLKGHIISDGGCTCPGDVAKAFGAADFVMLGGMFSGHTECAGEVIRKLYGMSSDTAMNKHAEYRASEGK
3c0jA           --GRIPVIAGTGANATAEAISLTQRFVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDL--PQILYNVPSRT
2a6lA           --GRIPVIAGTGANATAEAISLTQRFVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSHTGC
2dzpB           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
3eb2D           --RRVPVVAGVASTSVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEI-----PVV
2e09A           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2c3zA           IPSNVVKVAESGISERNEIEELRKLVNAFLIGSSLMRNPEKIKE--------------------------
3b5vA           IPSNVVKVAAFGISARNEIAELRALVNAFSIHSSLMRNPEKIKE--------------------------
2dzpA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2e09B           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2dzuA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2dzwA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGRE-------------------------
3b4uA           GIAPSRIVTGVLVDSIEDAADQSAEARNILLAPPSYFKNVSDDGLFAWFSAVFSKIKDARDILVYNIPSV
1a53A           IPSNVVKVAESGISERNEIEELRKLVNAFLIGSSLMRNPEKIKE--------------------------
3daqA           --KRVPVIAGTGTNDTEKSIQASIQADAIMLITPYYNKTNQRGLVK--HFEAIAD-AVKLPVVLYNVPSR
2dzuB           ICRNKV-AVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
1dwxA           LW-NSQLIRYAGY-QMPDGTIRGDTLEFTQLCIDLGWKPRYGRFDVLPLVLQADGQD-----PEVF--EI
2dzvB           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGREATEFLKKK-----------------
1ak5A           G-IYIPVCSDGGIVYDYHMTLALAMADFIMLGRYFARFEESPTR--------------------------
2dzxA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2dzsB           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGREATEFLKKK-----------------
2a7rB           HGLKGHIISDGGCSCPGDVAKAFGAADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSS---------
3di1A           --KRVPVIAGTGTNDTEKSIQASIQADAIMLITPYYNKTNQRGLVK--HFEAIAD-AVKLPVVLYNVPSR
3denA           ADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYWNRPSQEGLYQHFKAIAEHTDLPQILYNVP
2a6nA           --GRIPVIAGTGANATAEAISLTQRFVGCLTVTPYYNRP--------SQEGLYQHFKAIAEHTDLPQILY
3c56B           SVEELGRLMVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEAIPDNVRKSYLDAGG
3bggA           VQLEA-GGDNLGQQYNSPQEVIGKRSDIIIVGRGIISAADRLEAAEM-----------------------
2dztB           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2ehhC           --GRIKVIAGTGGNATHEAVHLTAHADGALVVVPYYNKPTQRGLYE----------HFKTVAQEVDIPII
3eahA           --WNSQLVRYAGYR-QQDGSVRGDPVEITELCIQHGWTPGN-----------------------------
2dzvA           ICR-NKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
2aqwA           LSPGI-GAQNGDLYKTLKNGYNKDYELLINVGRAITKSPDPKKSSES-----------------------
1ea0A           ----------------------------------------------------------------------
2dzaB           HA-RYRDVVAEVKAFLEAQARRALSAPQVVLDPGFGHNLALLRRLDEIVALGHPVLVSRKRTIGELSGVE
3barA           SPGI--GAQNGDLHKTLTNGYHKSYEILINIGRAITKNPYPQKAAQM-----------------------
2ehhA           --GRIKVIAGTGGNATHEAVHLTAHADGALVVVPYYNKPTQRGLYE----------HFKTVAQEVDIPII
3dqsA           IWN-SQLVRYAGYRQ-QDGSVRGDNVEITELCIQHGWTPGN-----------------------------
1dvjC           IIGQDSFLISPGVGAQGGDPGETLRADAIIVGRSIYLAD-------------------------------
1ad1B           IVG-FDVKISVDTFRSEVAEACLKLGDIINDQWAGLYDHRMFQVV-------------------------
1dwxB           LW-NSQLIRYAGYQ-MPDGTIRGDTLEFTQLCIDLGWKPRYGRFDV-------LPLVLQADGQDPEVFEI
3eb2A           AQRRVPVVAGVASTSVADAVAQAKLYDGILAILEAYFPLKDAQIES------------------------
3dz1A           --SQVIVGVSAPGFAARRLARLSDAAAGVIAPPPSLRTDEQITTY-------------------------
2dqwB           ----------------------------------------------------------------------
3dfyB           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
1dkwA           ------ILYGGSVNGKNARTLYQQRVNGFLVGLKP-----------------------------------
3dfyL           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
3eisA           -----ATGLPCTTMSTAVLNGLRALVRRVALATAYIDDV-------------------------------
3dfyF           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
3e68B           RLWNSQLIRYAGY-QMPDGTIRGDTLEFTQLCIDLGWKPRYGRFDV-------LPLVLQADGQDPEVFEI
1dvjA           IIGQDSFLISPGVGAQGGDPGETLRADAIIVGRSIYLAD-------------------------------
1efzA           MLPDDKPHYLMGVGKPDDIVGAVERIDMFDCVLPTRSGR-------------------------------
3dqtB           RIWNSQLVRYAGYRQ-QDGSVRGDPVEITELCIQHGWTPGN-----------------------------
3cb3C           QFD-TPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIAS--LAEHAGLMLAHFAMELHV-HL
3e7gC           RVWNAQLIRYAGYQM-PDGSIRGDNVEFTQLCIDLGWKPKY-----------------------------
3dfyE           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
3eb2B           AQRRVPVVAGVASTSVADAVAQAKLYEKLGADGILAILEA------------------------------
3dfyH           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
3dfyN           HSPF-PVAADESARTKFDVMRLVKEVDYVNIKLMKSGISDALAIVE------------------------
3eegA           KET-LGLETGINHKKLVPISHLVS----------------------------------------------
3bi8A           VNKRIPVIAGTGSNNTAASIAMSKWADGLLVITPYYNKTTQKGLVK------------------------


                         .         *         .         .         .         .         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPC
3c52B           RKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANK-----------------
1bkhA           FLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARF--
1amkA           ---------------------------------------------------------
1djqA           ---------------------------------------------------------
1bkhB           FLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARF--
3dfhA           VNTHLHNAAIQEHVEYNGNTHKVFPNAAEPINGYLYASEIAGIGVEIDREAAAEFP-
1djnA           PPMICTQNATAGEEYRRGWHPEKFRQTKNKDSV------------------------
3dipB           LALHAPTAIFQEVVRASWDLVDHLPVIQEGIALAPT---RPGLGTALLPHVRKIAG-
3dwjA           LEVTMEHPKYEWFQELGLKWY-ALPAVANMLLEVGG-LEFPACP-------------
2dw6A           AGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPD---LPGIGFEGKSDLYKEMK-
3e5bD           ETSKPDLAQARRFAEAVHKAHPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGY
3egbB           ---------------------------------------------------------
1chrA           YSTVPSLPFGCELIGPFVLADTLSHEPLEIRDYELQVPTGVGHGMTLDEDKVRQYA-
3eahB           ---------------------------------------------------------
3dipA           PTAIFQEVVRASLATWYADLVDHLPVIQEGIALAPT---RPGLGTALLPHVRKIAG-
2bahA           SCLSNFRLPGDTSSASRYWERDLIQEPLEAVDGLMPVPQGPGTGVTLDREFLATVT-
3e5bB           ME---TSKPDLAQARRFAEAVHKAHPGKLLAYNCSP-SFNWKKNLDDATIAKFQR--
2dw7A           AGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPD---LPGIGFEGKSDLYKEMK-
3bsmA           AAIHFPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYP-
3c6eA           LTGYGTVTMECSPRTLDFEMVLLQMENKAWLVHRQWFLDLPLPW-------------
3c4uA           NEDKDLRKFFSPAQLAL----------------------------------------
1bwkA           EEALKLGWDKS----------------------------------------------
3e7mA           PPDLVLEVTMEHPKYEELGLWYALPAVANMLLEVGEFPACP-----FNGWYMGTEI-
3dwjB           PPDLVLEVTMEHPKYQELGLWYALPAVANMLLEV-----------------------
1b9bA           ---------------------------------------------------------
3b8iA           A--------------------------------------------------------
3b8iB           ---------------------------------------------------------
3ct2A           SWDTELFGPLLLTEDILAEPPVYRDF----HLHVSK---APGLGLSLDEERLAFFR-
1bwlA           ---------------------------------------------------------
3bjsA           LAATENAGYFEACVSKFNPFRDMFGTFEIGADGCVEPPDAPGLGIEVDESIFEKYP-
2dp3A           ---------------------------------------------------------
1dtnA           LAATPTAHWLQRL-DLAGSVIEPTLTFEGGNAVIPD---LPGVGIIWREKEIGK---
1df1A           T--------------------------------------------------------
1d3hA           ---------------------------------------------------------
3c5xA           TVTMECSPRGLFNEMVLLQMENKAWLVHRQWFLDLPLPWLPGA--------------
1d3gA           ---------------------------------------------------------
3b8iD           ---------------------------------------------------------
2a4aB           ---------------------------------------------------------
3dg3A           GTAFERTSRHGELSNFLDMSDDLLTVPLQISDGQLHRRPGPGLGIEIDPDKLAHYR-
1bkhC           FLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARF--
3bjsB           LAATENAGYFEACVSKFNPFRDMFGTFEIGADGCVEPPDAPGLGIEVDESIFEKYP-
2an2A           SDMKLEVGGIHYNAAFNGWYMGTEIGARNLA--------------------------
2e77C           QLTGSQN--VEDLKGLDL---------------------------------------
3cb3B           HVHLAAAYPREPWVEHFEWLEPLFNERIEIRDGRMLVPTRPGLGLTLSGQVKAWTR-
3ddmA           ASPGLLGVDANDN-PLRSLLSPALATLHEGRITLGG---APGLGVTPDLAALRA---
1dbtA           ---------------------------------------------------------
1dkwB           ---------------------------------------------------------
2abbA           ---------------------------------------------------------
2e68B           ---------------------------------------------------------
2a7rC           TVEVPFKGDVEHTIRDILGGIRTYVGAAKLKE-------------------------
3bpwB           ---------------------------------------------------------
2a4aA           ---------------------------------------------------------
1dbtB           ---------------------------------------------------------
1eepA           KGGL-----------------------------------------------------
2bznB           EGKTVEVPFKGDVEHTIRDILGGIRSTCT----------------------------
3b8iE           A--------------------------------------------------------
2djxA           ---------------------------------------------------------
1al7A           ---------------------------------------------------------
2cu0A           VEGVVP--YRGTVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVIITHA------
2a1yA           EQDL-----------------------------------------------------
2b4gB           ---------------------------------------------------------
2e77B           QLTGSQN--VEDLKGLDL---------------------------------------
3e65B           PPDLVLEVTMEH---------------------------------------------
1eepB           MS-------------------------------------------------------
2dzwB           ---------------------------------------------------------
3cb3A           --HLAAAYPREPWVEHFEWLFNERIEIRDGRMLVPT---RPGLGLTLSGQVKAWTR-
2b4gA           ---------------------------------------------------------
3e7sA           ---------------------------------------------------------
1eb3A           ---------------------------------------------------------
3e49A           PHPEDLAHRRTADRLFGADYVWSILGAGRHQIPLASIGAAQGANVRV----------
1al8A           ---------------------------------------------------------
2a7nA           ---------------------------------------------------------
2bznC           EGKTVEVPFKGDVEHTIRDILGGIRSTCTYVG-------------------------
3c52A           NEQFDLRKFFSPAQLALK---------------------------------------
1b3oA           --GAKSLTQVRAMMYSGELKFEKRTSS------------------------------
2du2A           ---------------------------------------------------------
2dzsA           ---------------------------------------------------------
2dzxB           ---------------------------------------------------------
3e7gA           ---------------------------------------------------------
2cffA           ---------------------------------------------------------
2e77A           ---------------------------------------------------------
3ceuB           ---------------------------------------------------------
2bleA           ASEGKTVEVP--YKGDVENTILDILGGLRSTCTY-----------------------
2bznA           TVEVPFKGDVEHTIRDILGGIRTYVGAAKLK--------------------------
3b8iC           ---------------------------------------------------------
2a7rD           VPFKGDVEHTIRDILGGIRSTCTYVGAAKLK--------------------------
2a7rA           AEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRV---
2csbA           ---------------------------------------------------------
2bznD           TVEVPFKGDVEHTIRDILGGIRSTCTYVGAAK-------------------------
2dztA           ---------------------------------------------------------
2c6qG           EGKTVEVPFKGDVEHTIRDILGGIRSTCT----------------------------
2agkA           ---------------------------------------------------------
3c3nA           ---------------------------------------------------------
1b3oB           S-----LTQVRAMMYSGELKFEKRTSSA-----------------------------
2bwgB           SEGKTVVPYKGDVENTILDILGGYVGAAKLK--------------------------
2bwgA           AEYRASEGKTVPYKGDVENTILDILGGLRST--------------------------
3dgbA           SWDTELFGPLLLTEDILAEPPVYRDF----HLHVSK---APGLGLSLDEERLAFF--
2djlA           ---------------------------------------------------------
3dg6A           GTAFERTSRHAGELSNFLDMSDLLTVPLQISDGQLHRRPGPGLGIEIDPDKLAHYR-
2btmA           ---------------------------------------------------------
1btmA           ---------------------------------------------------------
1dd7A           MELGLKWYALANMLLEVGGLEFPACPFNGWYMNVAVLHSFQKQNVTI----------
2e68A           ---------------------------------------------------------
3dfyA           ---------------------------------------------------------
3di0A           TNMTIEPETVEILSQHIVALKDATNDFEYLEEVKKRIDTN-----------------
3di0B           TNMTIEPETVEILSQHIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQ
3c61A           ---------------------------------------------------------
2c6qA           GVAE--YRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAALKELSRR------
2c6qB           GVAE--YRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAALKELSRR------
3cjpA           NDSYVANAVLGDNISRLLNI-------------------------------------
2cu0B           VEGVVP--YRGTVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVIITHA------
3e7sB           ---------------------------------------------------------
2c18B           ---------------------------------------------------------
3di1B           TNMTIEPETVEILSQHIVALKDATNDFEYLEEVKKRIDTN-----------------
1dqwA           ---------------------------------------------------------
2bwgD           TVEVPYKGDVENTILDILGGLRTYVGAAKLKE-------------------------
3c0jA           GCDLLPETVGRLAKVKNIIGIEATGNLTRVNQ-------------------------
2a6lA           DLLPETVGRLAKV-KNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQL
2dzpB           ---------------------------------------------------------
3eb2D           IYTNPQFQRSDLTLDVIARLAERIRYIKDASTNTG----------------------
2e09A           ---------------------------------------------------------
2c3zA           ---------------------------------------------------------
3b5vA           ---------------------------------------------------------
2dzpA           ---------------------------------------------------------
2e09B           ---------------------------------------------------------
2dzuA           ---------------------------------------------------------
2dzwA           ---------------------------------------------------------
3b4uA           TMVTLSVELVGRLKAAFPGIVTGVKDSSGNWSHTER---------------------
1a53A           ---------------------------------------------------------
3daqA           TNMTIEPETVEILSQHIVALKDATNDFEYLEEVKKRIDTNS----------------
2dzuB           ---------------------------------------------------------
1dwxA           PPDLVLEVTMEHPKYEWLGLWYALPAVANMLLE------------------------
2dzvB           ---------------------------------------------------------
1ak5A           ---------------------------------------------------------
2dzxA           ---------------------------------------------------------
2dzsB           ---------------------------------------------------------
2a7rB           -----EMAMKKYAGGVAEYRSEGKTVEVPFKGDVEHTIRDILGGIRSTCTYV-----
3di1A           TNMTIEPETVEILSQHIVALKDATNDFEYLEEVKKRIDT------------------
3denA           SRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSD---------------
2a6nA           NVPSATGCDLLPETVGRLAKVKNIIGIKEATGNL-----------------------
3c56B           DLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKV----------------
3bggA           ---------------------------------------------------------
2dztB           ---------------------------------------------------------
2ehhC           IYNIPSRTCVEISVDTMFKLASECENIVASK--------------------------
3eahA           ---------------------------------------------------------
2dzvA           ---------------------------------------------------------
2aqwA           ---------------------------------------------------------
1ea0A           ---------------------------------------------------------
2dzaB           DQRVH-----GSVAAHLFAVMKGVRLLR-----------------------------
3barA           ---------------------------------------------------------
2ehhA           IYNIPSRTCVEISVDTMFKLASECEASKESTPNMDRISE------------------
3dqsA           ---------------------------------------------------------
1dvjC           ---------------------------------------------------------
1ad1B           ---------------------------------------------------------
1dwxB           PPDLVLEVTMEHPKYE-----------------------------------------
3eb2A           ---------------------------------------------------------
3dz1A           ---------------------------------------------------------
2dqwB           ---------------------------------------------------------
3dfyB           ---------------------------------------------------------
1dkwA           ---------------------------------------------------------
3dfyL           ---------------------------------------------------------
3eisA           ---------------------------------------------------------
3dfyF           ---------------------------------------------------------
3e68B           PPDLVLEVTMEHPKY------------------------------------------
1dvjA           ---------------------------------------------------------
1efzA           ---------------------------------------------------------
3dqtB           ---------------------------------------------------------
3cb3C           AAAYPREPWVEHF-EWLEPLFNERIEIRDGRMLVPT---RPGLGLTLSGQVKAW---
3e7gC           ---------------------------------------------------------
3dfyE           ---------------------------------------------------------
3eb2B           ---------------------------------------------------------
3dfyH           ---------------------------------------------------------
3dfyN           ---------------------------------------------------------
3eegA           ---------------------------------------------------------
3bi8A           ---------------------------------------------------------