[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA59494.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bolB.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "2e7fA.bssp"
#ERROR : Can't open dsspfile "3bofB.bssp"
#ERROR : Can't open dsspfile "1beuA.bssp"
#ERROR : Can't open dsspfile "3dg9A.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "3c4uA.bssp"
#ERROR : Can't open dsspfile "3cu2A.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "3bofA.bssp"
#ERROR : Can't open dsspfile "1ad4B.bssp"
#ERROR : Can't open dsspfile "1dquA.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "2dzuA.bssp"
#ERROR : Can't open dsspfile "2dzpA.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "2ekcB.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "2dztA.bssp"
#ERROR : Can't open dsspfile "2c3zA.bssp"
#ERROR : Can't open dsspfile "1dbtB.bssp"
#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "2e09A.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "2e28A.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2dzxA.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "3ct7A.bssp"
#ERROR : Can't open dsspfile "2a7nA.bssp"
#ERROR : Can't open dsspfile "1b9bA.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "2agkA.bssp"
#ERROR : Can't open dsspfile "2dzvA.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "3dtvD.bssp"
#ERROR : Can't open dsspfile "2bdqA.bssp"
#ERROR : Can't open dsspfile "1dbtA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "3bw4A.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "3bpwB.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "3b8iB.bssp"
#ERROR : Can't open dsspfile "3cepA.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "3eisB.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "3bw2A.bssp"
#ERROR : Can't open dsspfile "2a7rD.bssp"
#ERROR : Can't open dsspfile "1c29A.bssp"
#ERROR : Can't open dsspfile "2dzwB.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "2dzsA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"
#ERROR : Can't open dsspfile "2dp3A.bssp"
#ERROR : Can't open dsspfile "2dzsB.bssp"
#ERROR : Can't open dsspfile "2dzwA.bssp"
#ERROR : Can't open dsspfile "2abbA.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "3bw3A.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "2dzpB.bssp"
#ERROR : Can't open dsspfile "2dztB.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "2dzvB.bssp"
#ERROR : Can't open dsspfile "3d0cB.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "3barA.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "1btmA.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "2dqwA.bssp"
#ERROR : Can't open dsspfile "2btmA.bssp"
#ERROR : Can't open dsspfile "2bbfA.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "2dzbA.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "3di1A.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "3dtvC.bssp"
#ERROR : Can't open dsspfile "3bllA.bssp"
#ERROR : Can't open dsspfile "3dz1A.bssp"
#ERROR : Can't open dsspfile "1bksA.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "2clhA.bssp"
#ERROR : Can't open dsspfile "3daqA.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "1dvjA.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "3eezA.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "3c5xA.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "3b8iD.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "3bggA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "3eahB.bssp"
#ERROR : Can't open dsspfile "1dvjC.bssp"
#ERROR : Can't open dsspfile "3dtvB.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"

## Summary of PDB Search
:249
    8e-22  10%  3bolB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    6e-21  29%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    4e-20  23%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    9e-19  10%  2e7fA  [x.x.x] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
    1e-18   9%  3bofB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    3e-18  13%  1beuA  [c.1.2] TRYPTOPHAN SYNTHASE
    2e-16  12%  3dg9A  [x.x.x] ARYLMALONATE DECARBOXYLASE
    7e-16  12%  2a1yA  [x.x.x] GMP REDUCTASE
    1e-15  12%  3c4uA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    2e-15  10%  3cu2A  [x.x.x] RIBULOSE-5-PHOSPHATE 3-EPIMERASE
    3e-15   9%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    1e-14  10%  3bofA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    9e-14   9%  1ad4B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    1e-13  14%  1dquA  [c.1.12] ISOCITRATE LYASE
    1e-13  10%  2a7rC  [x.x.x] GMP REDUCTASE 2
    3e-13   8%  2dzuA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-13   8%  2dzpA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-13  15%  1a50A  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    9e-13  13%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    1e-12   9%  2ekcB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-12  14%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-12   8%  2dztA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-12  14%  2c3zA  [x.x.x] INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE
    9e-12   8%  1dbtB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    9e-12   9%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-11   9%  2e09A  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-11  11%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    2e-11  12%  2e28A  [x.x.x] PYRUVATE KINASE
    2e-11  13%  2c6qA  [x.x.x] GMP REDUCTASE 2
    3e-11   8%  2dzxA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-11  10%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    6e-11  14%  1a53A  [c.1.2 (1lbfA)] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    1e-10  13%  3b5vA  [x.x.x] RETROALDOLASE-22
    1e-10  10%  2bleA  [x.x.x] GMP REDUCTASE I
    1e-10   9%  3ct7A  [x.x.x] D-ALLULOSE-6-PHOSPHATE 3-EPIMERASE
    2e-10  11%  2a7nA  [x.x.x] L(+)-MANDELATE DEHYDROGENASE
    2e-10  12%  1b9bA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    2e-10  10%  2c6qB  [x.x.x] GMP REDUCTASE 2
    3e-10  13%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    3e-10  16%  2agkA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    4e-10  10%  2dzvA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-10  12%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    8e-10   8%  2csbA  [x.x.x] TOPOISOMERASE V
    1e-09  13%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    2e-09  17%  3dtvD  [x.x.x] ARYLMALONATE DECARBOXYLASE
    2e-09  15%  2bdqA  [x.x.x] COPPER HOMEOSTASIS PROTEIN CUTC
    2e-09   8%  1dbtA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-09  13%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-09  13%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    3e-09  10%  2a7rB  [x.x.x] GMP REDUCTASE 2
    3e-09  24%  3bw4A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    3e-09  13%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    4e-09  11%  3bpwB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-09  11%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    6e-09  14%  3b8iB  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    6e-09  12%  3cepA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-09  14%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    8e-09  14%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    9e-09  16%  3eisB  [x.x.x] ARYLMALONATE DECARBOXYLASE
    9e-09  10%  2bwgB  [x.x.x] GMP REDUCTASE I
    1e-08  24%  3bw2A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    1e-08  10%  2a7rD  [x.x.x] GMP REDUCTASE 2
    1e-08  12%  1c29A  [c.1.2] TRYPTOPHAN SYNTHASE
    2e-08  14%  2dzwB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-08  11%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-08  12%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    2e-08  14%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-08  13%  2dzsA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-08  16%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    3e-08  14%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-08  13%  2dp3A  [x.x.x] TRIOSEPHOSPHATE ISOMERASE
    4e-08  16%  2dzsB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-08  14%  2dzwA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-08  13%  2abbA  [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    5e-08  10%  2du2A  [x.x.x] LACTATE OXIDASE
    5e-08   8%  2a7rA  [x.x.x] GMP REDUCTASE 2
    5e-08  13%  3dfhA  [x.x.x] MANDELATE RACEMASE
    6e-08  13%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    6e-08  28%  3bw3A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    8e-08  13%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    8e-08  14%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    8e-08   9%  2dzpB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    8e-08  15%  2dztB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-07  14%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    1e-07  12%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-07  11%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-07  10%  2dzvB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-07  13%  3d0cB  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-07  13%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-07  11%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-07  12%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    4e-07  10%  2e77B  [x.x.x] LACTATE OXIDASE
    4e-07  11%  3barA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    9e-07  11%  2bwgD  [x.x.x] GMP REDUCTASE I
    9e-07  13%  1btmA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    1e-06  12%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-06  14%  2dqwA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-06  14%  2btmA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    3e-06  17%  2bbfA  [x.x.x] TRNA GUANINE TRANSGLYCOSYLASE
    3e-06  11%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-06  14%  2dzbA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    3e-06  10%  2bwgA  [x.x.x] GMP REDUCTASE I
    4e-06  12%  3di1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-06   5%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    4e-06  14%  2e77C  [x.x.x] LACTATE OXIDASE
    5e-06  15%  3dtvC  [x.x.x] ARYLMALONATE DECARBOXYLASE
    6e-06  19%  3bllA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    6e-06   8%  3dz1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-06  14%  1bksA  [c.1.2] TRYPTOPHAN SYNTHASE
    1e-05  15%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    1e-05  10%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    1e-05  15%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    1e-05  15%  2clhA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-05  13%  3daqA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-05  10%  2e77A  [x.x.x] LACTATE OXIDASE
    5e-05  12%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    5e-05  10%  1dvjA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    8e-05  13%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-04  11%  3eezA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    1e-04  11%  2bznB  [x.x.x] GMP REDUCTASE 2
    2e-04  17%  1efzA  [c.1.20] TRNA-GUANINE TRANSGLYCOSYLASE
    2e-04   8%  3c5xA  [x.x.x] ENVELOPE PROTEIN E
    2e-04  14%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    3e-04  13%  3b8iD  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    4e-04  10%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-04  11%  3bggA  [x.x.x] URIDINE 5'-MONOPHOSPHATE SYNTHASE
    4e-04   7%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    4e-04   8%  3eahB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    7e-04  11%  1dvjC  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    0.001  16%  3dtvB  [x.x.x] ARYLMALONATE DECARBOXYLASE
    5e-06   9%  3c6eA  [x.x.x] ENVELOPE PROTEIN E(query 138->236)
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
3bolB           -----------INPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTLP
2cffA           MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
2a0nA           KRIIACLDVKDGRVVKGTNFE---NLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
2e7fA           MLIIGER--INGMFGDIKRAIQERDP---APVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQ
3bofB           TFDHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTLP
1beuA           --YENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRA
3dg9A           --LYPDLPFIASG-LGLGSVTPEGYDAVIESVVDHARRLQKQGAAVVSLMGTLSFYRGAAFNAALTVAMR
2a1yA           ---CIVNSRSECDTTVTLGKHKFKLPVVPANMQTIIDERIATYLAENNYFYIMHRFQPEKRISFIRDMQS
3c4uA           ----------------HKEGYGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIM
3cu2A           -----------------------------LQLNEEVTTLLENQINVLHFDIADGQFSSLFTVGAIGIKYF
1ad1B           ---------------KTKIMGILNVTPNVESAVTRVKAMMDEGADIIDVGGVSTMITVEEELNRVLPVVE
3bofA           TFDHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTLP
1ad4B           -----------------------------ESAVTRVKAMMDEGADIIDVGGVMITVEEE---LNRVLPVV
1dquA           ---LDTVYVSGWQSSSTASSTDEPSPDLADYPMNTVPNKVNHLWMAQLFHDRKQREERMTTPKDQRHKVA
2a7rC           ---RSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP
2dzuA           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2dzpA           -SLIPYLTAGDPNKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
1a50A           -----------------------------EQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRA
3eb2B           ----------------------------------------------------------------------
2ekcB           --ISDKFTELKEKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVA
2dzbB           -----------------------------ERALERAREMVAEGA---DILDLGAESTPVEEEKRRLLPVL
2dztA           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2c3zA           ----PIISLNERILEFNKRNITAPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIA---
1dbtB           -----------------------------ASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKER
2dzuB           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2e09A           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2aqwA           -------------------------------------------KEYALVYKNFAFYPYGSVGINALKNVF
2e28A           ----------------------------------------------------------------------
2c6qA           ------VDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP
2dzxA           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
3c61A           ---FAHFDAAAEILNEFPQVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANVNAFY
1a53A           SRQRPIISLNERILEFNKRNITAIIAEYVERDPIEYSKFMERYAVGLSILTEEKYFNGS----YETLRKI
3b5vA           -----------------------------ERDPIEYSKFMERYAVGLSITTEAKYFNGSYETLRAI----
2bleA           -------------------------------------KVGVGPGSVCTTRTKTGVGYPQLSAVIECADSA
3ct7A           ------------------------------LKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQV
2a7nA           GALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTLT
1b9bA           ----------------------------------LSGRNIKLGAQNVFYED-QGAFTGEISPLMLQEIGV
2c6qB           ---RSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP
1chrA           -----IKIIVERYLAPHLLGTDAFNVSGALQTMARAVTGNASAAVEMALLDLKARALGVSIAELLGGPLR
2agkA           --FIGCIDLHNGEVKQQ------------HPSSYYAKLYKDRDVQGCHVIKLG------PNNDDAAREAL
2dzvA           -SLIPYLTAGDPDKQSTLNFLLALDEIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHSSTP
3b8iA           --------LDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQATRIG
2csbA           ----------------------------------------------------ATRYLERSSSAKNDEELL
1al8A           ---DRSLSWKDVAWLQTITSLPILVKGV--ITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV
3dtvD           --LYPDLPFIASGLGLGSVTPEGYDAVI-ESVVDHARRLQKQGAAVVSLMGTSLSFRGAAFNAALTVAMR
2bdqA           ----------------------------CAENLTDLTRLDKAIISRVELCDNLAVGGTTP--SYGVIKEA
1dbtA           -----------------------------ASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKER
2e68B           -------------AAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILLANVNAFY
1b3oB           ----YIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYA
2a7rB           ---RSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP
3bw4A           ----------------------------------------------------------------------
1eepB           ------------------------------SVGADCLKVGIGPGSICTTRIVAGVGVPQITAICDVYEAC
3bpwB           ----------------------------------------YALTFKMNFAFYIPYGSVGIDVLKNVFDYL
2b4gA           -------------AAVLNDFPLVKFITCVNSIGNGLVIDPANETVVIKPKQGFGGLGGKYVLLANVNAFF
3b8iB           --------LDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQIGRVA
3cepA           --YENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRA
2dqwB           -----------------------------ERALERAREMVAEGA---DILDLGAESPVEEEKRRLLPVLE
3eb2D           ----------------------------------------------------------------------
3eisB           --LYPDLPFIASGLGLGSVTPEGYDAVIES-VVDHARRLQKQGAAVVSLMGTSLSFRGAAFNAALTVAMR
2bwgB           ----------------------------------MVEELILSGADIIKVGVGPGSVYPQLSAVIECADSA
3bw2A           ----------------------------------------------------------------------
2a7rD           ----SEVDLTRSFSFRNSKQTYSGVPIIANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPD
1c29A           -AFVPFVTLGDPGIEQSLK-IIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEML
2dzwB           ----PVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAK
3c3nA           -------------AAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYIALANVNAFY
2an2A           ------------------RLFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGIFPPEEKGEKQVEIWN
2cu0A           ---------------------------------ADAVKVGIGPGSICTTRIVAGVGVPQITAVAMVADRA
2dzsA           ------------TEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAK
1al7A           ------------------------------ITAEDARLAVQHGAAGIIVSNHGARLDYVPATIMALEEVV
2dzxB           ---LPVFHAKEFTEIARAAGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAK
2dp3A           ------------------------------------------AAQNVYLEGN-GAWTGE-TSVEMLQDMG
2dzsB           ----PVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEIPKTAYDLLRRA
2dzwA           -------------EIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAK
2abbA           ---WSADRIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRGIAYLHMSETDLAGGKPYSEAFRQKVRE
2du2A           ---KQKISPRDIEEIAGHSGLP--VFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAI
2a7rA           ------------------------------LSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
3dfhA           --LKPILIGKNANNIEDLWQMMMVNA----YWRNGPVINNAISGVDMALWDIKAKLAGMPLHQLFGGKSR
1b3oA           -------FQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGV---DALRVGMGSRPQATAVYKVSEYA
3bw3A           ----------------------------------------------------------------------
1bwlA           ---WVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQAKKANNPQHSLTKDEIKQYIKEYVQAAKNSI
2e09B           -----------------EEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAK
2dzpB           -SLIPYLTAGDPNKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIV
2dztB           ------------TEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEIPKTAYDLLRRA
3b8iE           --------LDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQATRIG
3bi8A           ----------------------------------------------------------------IFKGSG
1ak5A           ------------------------------VDGEGFRYLADAGADFIKIGIGRGQATAVIDVVAERNKYF
2dzvB           -SLIPYLTAGDPDKQSTLNFLLALDEYA--GAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAF---
3d0cB           --------------------------------------------------------------------IS
2djxA           -------------AAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVN
2djlA           -------------AAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYIALANVNAFY
2b4gB           ------------------------------NGLVIDPANETVVIKPKQGFGGLGGKYVLPTALANVNAFF
2e77B           ---------------EIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAI
3barA           --------------------------------IDVLKNVFDYLYELNIPTILDMKINDIGNTVKNYRKFI
2bwgD           --FVKLVRAKFPEHTIMA-GNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECAD
1btmA           ---------------------GLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPE
2ehhC           ----------------------------------------------------------------------
2dqwA           ----------------------------TPRALERAREMVAEGA---DILDLGAE----EEEKRRLLPVL
2btmA           -------------------------EQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPE
2bbfA           ---RDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVG-EGQDEMFRVLDFSV
2ehhA           ----------------------------------------------------------------------
2dzbA           ----------------------------TPRALERAREMVAEGADILD------LGAESEEEKRRLLPVL
2bwgA           ------VDLERTFTFRNSKQTYSGIPIIANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPE
3di1A           ----------------------------------------------------------------LFEGVG
3c6eA           -------------------NKPTLDFELIKTEAKQPATLRKYCIEAKLTNTPSLNEEQDKRFVCKHSMVD
2e77C           --------------------------------PEDADMAIKRGASGIWVSNHGARLYEAPGSFDTLPAIA
3dtvC           -------------------GLGLGYDAVIESVVDHARRLQKQGAAVVSLMGTSLSFYRGAANAALTVAMR
3bllA           --------------------------VFENLRQQSADALAEIGF---DGYAVGGLSEGQDEMFRVLDFSV
3dz1A           ----------------------DDGKIDDVSIDRLTDFYAEVGCEGVTVLGILGEAPKLDAAEAATRFIK
1bksA           --NLFAQLNDRREGAFVPFVTLGDPGI--EQSLKIIDTLIDAGADALEL----GVPFSDPLADGPTIQNA
1bkhA           -------------------------------------NTFAKSGIESALLDAQGKRLGLPVSELLGGRVR
3ddmA           -------------------------------------------------------------------WLG
1bwkA           ----------------------------------------------------------------------
2clhA           ---------------------VTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRA
3daqA           ----------------------------------------------------------------------
2e77A           --------------------------------PEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAI
2cu0B           ------------------------------DDLTFADAVKVGIGPGSICTTRIVAGVGVPQITAVAMVAD
1dvjA           -------------CLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPPERLSRLR
2e68A           -------------AAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILLANVNAFY
3eezA           ------------------------------------GHLYAKSPIDMACWDIAGQAAGLPIADLMGGGSR
2bznB           ------------------------------LSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAA
1efzA           ---RDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVG-EGQDEMFRVLDFSV
3c5xA           ----------------------------------------------------------------------
1eepA           -----------------------EAALDLISVGADCLKVGIGPGSICTTRIVAGVGVPQITAICDVYEAC
3b8iD           ---------------------------------MSARIAADLGFECGILQVLAAPDFALITLSEFVEQAT
3dgbA           ----------------------------------------------------------------------
3bggA           -------------------------AEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFL
3e7sA           -------------------------------PKFPRVKNWELGSITYDTLCAQS---QQDGPCTPRRCLG
3eahB           ----------------------------------------------------------------------
1dvjC           -----------------------------------AEMFIQGAADEIARMGVDLGVKNYVGPPERLSRLR
3dtvB           ----------------------------------------------------------------------
3c6eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
3bolB           YV---SNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELKINLLKKYGGTLIVLLMGKDVPKSFEE
2cffA           E--FAEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREIDVEPV-FSLVTRGGRVAFKG
2a0nA           EQ-IDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAVDGEFMVFTYS
2e7fA           EVS-NLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSD
3bofB           YV-SNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLIVLLMGKD----VPK
1beuA           FAA-------GVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVE
3dg9A           EATGLPCTTMSTA-----VLNGLRALGVRVALATAYIDDVNERLAAFLAEESLVPTGCRSLGITGVEAMA
2a1yA           RGL-IASISVGVKEDEYEFVQQLAAEHLPEYITIDIAHGHSNAVINMIQHIKKHLPESFVIA--------
3c4uA           CERHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVK-------MAHNAGVSVEA
3cu2A           P--THCFKDVHLVRNQLEVAKAVVANGANLVTLQLEQYHDFALTIEWLAKQKTTYANQVYPVLIGACLCE
1ad1B           -AIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEIVLMHNG---NGNRDEP
3bofA           YV---SNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDELEMKINLLKKYGGTLIVLLMGKDVPKSFEE
1ad4B           EAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAKYDAEIVLMHNGNGNRDEPVVE
1dquA           NVDYDADTGHGGLTAVMKLTKLFVERGAAGIHIISEHINRLVAIRAQADIMGTLLAIARTDSEAHPFIIG
2a7rC           DCLEHLAASSGTGSSDFEQLEQILEAIPQVYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEM
2dzuA           KEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVNGILVVDL------PVFHAKEFTEIAREEGIKT
2dzpA           KEFRRHSST--PIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAR----EEGIKT
1a50A           FAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVELRHNIAP
3eb2B           ---LVSPVDAEGRVRADRLCDDLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATIEAAQRRVPVVA--G
2ekcB           LKN-GIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLVPDLPPEEAEELKAVMKKYVLSF
2dzbB           EAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPAHARYRDVVAE
2dztA           KEFRRHSTPIVLMTYYNPIYRAGVRNFLAEAKA-------SGVAGILVVDLPVFHAKEFTEIAREEGIKT
2c3zA           -SSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIE----------
1dbtB           NCELFLDLKLHDPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPVTQLTSTSEQIMKDEL
2dzuB           KRHSSTPIVLMTYYNPIYRAGVRNFL---------AEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKT
2e09A           KAFRRHSSTPIVLMTYYNPIYRAGVR------NFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKT
2aqwA           DYLNLDKINDIGNTVKNYRKFIFEYLKSDSCTINVYGTNLKDICFDYEKNKYYSAYVLIKTTNKDSFIFQ
2e28A           --------TIGPASESVDKLVQLMEAGMNVARLNFSHGDHEANIREAAKRTGRTVAILLDTKGPEIRTHN
2c6qA           DCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANFVEFVKDVRKRFPQHTIMAGNVVTGEMVEEL
2dzxA           KEFRRHSSTPIVLMTYYNPIYRA------GVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIARAAGIKT
3c61A           RRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFERLTAELLDVMAKKGYQTLD-EFRG
1a53A           ASSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSY----------------G
3b5vA           ASSVSIPILMADFIVKESQIDDAYNLGADTVALIVAILTEAELESLLAYARSYGMEPLIKI---------
2bleA           HGL-KGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHGVAE
3ct7A           KKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDM-------KVGLILNP
2a7nA           TDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLGKMDKANLEMQAALMSRQMDASFNWEALRWLRDLWPH
1b9bA           EYVIVGHSRIFKEDDEFRKVKAVLEKGMT-PILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEEAKRV
2c6qB           DCLEHLAASSGTGSSDFEQLEQILEAIPQVYICLDVANGYSEHFVEFVKDVRKRFPQHTIMA--GNVVTG
1chrA           SAIPIAWT--LASGDTKRDLDSAVEMIERRRHNRFKVFRSPQDDLIHMEA-----LSNSLGSKAYLRVDV
2agkA           QE-SPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLERLTELCGKDKTQDGRWIVAMNK
2dzvA           IVLMTYYN-PIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAP---------
3b8iA           RVARLPVIADADHGYGNATVVELERAGIAALTIEDTLLPAQFCVEEGVGKIRAALEARVDPALTIIARTN
2csbA           ELHQNILLTGSYACSIDPTEDRYQNVIVRGVNFDERVQRLSTGGSPARYAIVYRRGWRAAKALDIDEEDV
1al8A           VKAGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMM--RDEFELTMALSG
3dtvD           EATGLPCTTMSTAV-----LNGLRALGVRRVALATAYIDDVNERLAAFLAEESLVPTGCRSLGITGVEAM
2bdqA           NQYLHEKGISVAVIRPRGGNFVYNDLELRIEEDILRAVELESDALVLGILTTEAIEQLLPATQGLPLVFH
1dbtA           NCELFLDLKLHDIPTTVNAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPVTQLTSTSEQIMKDEL
2e68B           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYR--------
1b3oB           RR-FGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIG
2a7rB           DCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVT-G
3bw4A           ----------------------------------------------------------------------
1eepB           NN-TNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSEEIIYNG----KKFKSYGMVPYSGK
3bpwB           YELNIPTILDMKINDIGNTKFIFEYLKSDSCTVGTNMLKDICYDEEKNKYYSAFVLVKTTNPDSAIFQKN
2b4gA           RRCPDKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARLNKELQEIMTNKGYK--------
3b8iB           RLPVIADADHGYGNALNRTVVELERAGIAALTIEDTLLPAQFGVEEGVGKIRAALEARVDPALTIIARTN
3cepA           FAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEADVPVEESAPFRQAALRHNIAP
2dqwB           AVL-SLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAA--RHGVAAVVMHMPVPAHARYRD
3eb2D           ---LVSPVDAEGRVRADVMGRLLIQAGVHGLTPLGSTGEFAYLGTAQREAVVRATIEAAQRRVPVVA--G
3eisB           EATGLPCTTMST-----AVLNGLRALGVRRVALATAYIDDVNERLAA--FLAEESLVPTGRSLGITGVEA
2bwgB           HG-LKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDKHVAEYRASE
3bw2A           ----------------------------------------------------------------------
2a7rD           -CLEHLAASSGTGSSDFEQLEQILEAIPVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGN--VVTG
1c29A           ALIREKHPTI---PIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIF
2dzwB           RICR-NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVEALLG---------
3c3nA           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGR
2an2A           HQLIRYAGYEGEAIGDPASCSLTAACELGWRGERTDFDLLPLIFRMKGDEQPVWY---------------
2cu0A           QE-YGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVIINGRKYKQYRGMGSLGAMMKY
2dzsA           RIC-RNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
1al7A           KAAGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMM--RDEFELTMALSG
2dzxB           RICR-NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
2dp3A           LKHVIVGRRIMGETDEAKKAKRALEKG--MTVIFCVGETLDERKANRTMEVIAQLEALGKELGESKMLWK
2dzsB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
2dzwA           RICR-NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKVEALLG---------
2abbA           R--FHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVARLQKKAELNP---------------
2du2A           AERKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGASVLDYFQKDLTRVMQLTGSQN
2a7rA           HG-LKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKY
3dfhA           DAIPVYTHATSDGIYDLVEGFLEKGYKHIRCQLGFDQDQYMDNTLTMFKSLREKY-----GNQFHILHDV
1b3oA           RR-FGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIG
3bw3A           ----------------------------------------------------------------------
1bwlA           AAGADG-VEINSAHGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAILRLSPYGVFNSMSGG
2e09B           RIC-RNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
2dzpB           KEFRRHSST--------PIVLMTYYNPIYRAGVRNFLAEAKASGVDGVVDLPVFHAKEFTEIAREEGIKT
2dztB           KRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKKKV--------------
3b8iE           RVARLPDADHGYGNALNVTVVELERAGIAALTIEDTLLPAQFCVEEGVGKIRAALEARVDPALTIIARTN
3bi8A           VAIITPFTNTGVDFDKLELIEWHIKSKTDAIIVCGTTGEATTMTETERKETIKFVIDKVNKRIPVIA--G
1ak5A           EETIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESPTRKVTINGSVMKEYWGVDSYVPYAGK
2dzvB           WIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEG---IKT
3d0cB           GINIV-PFLEGTREIDWKGLEFLLQNGIEVIVPNGNTGEFYALTIEEAKQVATRVTELVNGRATVVAGIG
2djxA           AFYPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYR--------
2djlA           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGR
2b4gB           RRCPDKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARLNKELQEIMTNKGYK--------
2e77B           AERKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGASVLDYFQKDLTRVMQLTGSQN
3barA           FEYLKSDSCTVNIYMGTNMLKDIC------------------YDEEKNKYYSAFVLVKTTNPDSAIFQKN
2bwgD           SAHLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHAEYR
1btmA           AA-EAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQ-------------------------
2ehhC           ------PFKEGEVDYEANLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVK--RAAGRIKVIAG
2dqwA           EAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPVPDPATMMAHA
2btmA           AA-EAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLV-----------------------
2bbfA           PMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFT-----------------------
2ehhA           ----PFKEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVK--RAAGRIKVIAG
2dzbA           EAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRMVALAARHGVAAVVMHMPVPDPATMMAARYRD
2bwgA           CLQ-NVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGE
3di1A           VALTT-PFTNNKVNIEATHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVI---DLVDKRVPVIG
3c6eA           RGWNGCGLFGKGGIVTCAMFRCKKNMEGKVVQPENLEYTIVITPHSGEEHAGKH----------------
2e77C           ERVKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLLGGWQGAYSVLDYFQKDLTRVMQLTGSQN
3dtvC           EATG-----LPCTTMSTAVLNGLRALGVRRVALATAYIDDVN--ERLAAFLAEESLVPTGRSLGITGVEA
3bllA           PMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCGQAFTWDGPINIRN-----------------------
3dz1A           RAKSQVIVGVSAPGFAARRLARLSDAGAAGVIAPPPSLRTDEQITTYFRQATEAVLQDYPLTLSVVTPKV
1bksA           NLRAF---AAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVE
1bkhA           DSLEVAWTLASGTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTI--KRELGDSA---SVRVDV
3ddmA           GSGDRIGVYASGINPEEDVVARKAAEGYRAFKVGFDDARDVRNALHVRELLGAAT---------PLMADA
1bwkA           ---------------------------TRTDEYGGSIENRARFTLEVVDALVEAILRLSPYGVFNSMSGG
2clhA           FAA------GVTPAQCFEMLALIREKHPTIPIGLLMYANLVFFYARCEQVGVDSVLVADVPVELRHNIAP
3daqA           ------PFTNNKVNLEAAHVNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVID--LVDKRVPVIAG
2e77A           AERKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLAGGWQGAYSVLDYFQKDLTRVMQLTGSQN
2cu0B           RAQYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVIINGRKYKQYRGMGSLGAMMKY
1dvjA           EIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN-PAAAAAGIIESIKDLLIPED-------
2e68A           RRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYR--------
3eezA           TPRPIASSVGAKSVEE------TRAVIDRYRQRGYVAHSVKIGGDVERDIARIRDVEDIREPGEIVLYDV
2bznB           HG-LKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYK--------------
1efzA           PMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFT-----------------------
3c5xA           ---------------------------------NRDFVEGVSGGSWVDIVLEHGSCVTTMA---KNKP-T
1eepA           NN-TNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSEE------IIYNGKKFKSMVPYSGK
3b8iD           RIGRVARLIADADHGYGNTVVELERAGIAALTIEDTLLPAQFRST-DLICVEEGVGKIRAALEARIARTN
3dgbA           -----------------------------------------------------------------VRVDV
3bggA           HLTPGVQGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAAD-RLEAAEMYRKAAWEAYLSRLG------
3e7sA           SLVLPRKLLSQARDFINQYYSSIKRSGSQAHEERLEVASTGTYESELVFGAKQAWRNAPRC----VGRIQ
3eahB           ----------------------------------------QLRESELVFGAKQAWRNAPRC----VGRIQ
1dvjC           EIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAA-----------------------
3dtvB           ------------------VLNGLRALGVRRVALATAYIDDVN--ERLAAFLAEESLVPTGRSLGITGVEA
3c6eA           -------------------------------------------------------------------KPT


                         +         .         .         .         .         *         .:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
3bolB           R----KEYFEKALKILERHDFDRVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVGLSNLSFLPDRS
2cffA           WLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQ
2a0nA           GKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGK---MEHFL
2e7fA           TRLAFAMELVAAADEFMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNVSQNC---
3bofB           SFEERKEYFEKALKILERHDFSDRVIFDGVLPLGAEGKPVEVLKTIEFISSKGFNTTVGLSNLSFGLPDR
1beuA           RQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAV
3dg9A           RVDTATLVDLCVRAFEAAPDSDGILL------SCGGLLTLDAIPEVERRLGVPVVSSSPAGFWDAVRLAG
2a1yA           ----GNVGTPEAVRELENAGADATKVGIGPGKVCITGWQLAALRWCAKAASKPIIADGGIRTNGDVAKSI
3c4uA           ELGRVLVNPKEAEQFVKESQVDYLTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAI---PDNVR
3cu2A           TPISELEPYLDQIDVIQLLTLDPRNGTKYPSELILDRVIQVEKRLGNRRVEKLINIDGSTLELAKYFKQG
1ad1B           VVEEMLTSLLAQAHQAKIAGINKIWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLATSRKRFTKEM-
3bofA           R----KEYFEKALKILERHDFSDRVIFDGVLPLGAEGKPVEVLKTIEFISSKGFNTTVGLSNLSFGLPDR
1ad4B           EMLTSLLAQAHQAKIAGIP-SNKIWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLATSRKRFTKEMM
1dquA           STNPDIQPLNDLMVMAEQAGKNGAELQAIEDEWLAKAGLKLFNDAVVDAINNSPLPNKKA----------
2a7rC           VEELILSG--ADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAF
2dzuA           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
2dzpA           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
1a50A           IFICPPNADDDLLRQVASYG--RGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAV
3eb2B           VASTSVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEIPVVIYTNPQFQRSDLTLD
2ekcB           VPLGAPTSTRKRIKLICEAADEMTYFVSVAREKLPYERIKKKVEEYRELCDKPVVVGFGVSKKEHAREIG
2dzbB           VKA----FLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELS
2dztA           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
2c3zA           ------INDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELR
1dbtB           LIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVSPSFLTVTPGIRMSEDAANDQVRVATPAIAR
2dzuB           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
2e09A           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
2aqwA           NELSINDKQAYIVADETQKATELKIEQNNEFIGFVVGSNAFEEKIIRNKFPDSYIQNGDLYKTLKNGYNK
2e28A           MENG--------AIELKEGSKLVISMSEVLGTPEKISVTYPSLIDDVSVGAKILLDDGLIS---------
2c6qA           I------LSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAF
2dzxA           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
3c61A           KVR-------------------------------------------------------------------
1a53A           MEPLIEINDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELR
3b5vA           -------NDENDLDIALRIGARFIGIVSADWETLAINKANQAKLISMIPSNVVKVAAFGISARNEIAELR
2bleA           YRASEGKTVEVPYKGDVENTILDILG---GLRSTCTYVGAAKLKELSRRATFIRVTQQHN----------
3ct7A           ETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLM
2a7nA           KLLVKGLLSAEDADRCIAEGADGVISNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSGFRRGSDIVKAL
1b9bA           VIAYEPVWAIGTGRVATPQQAQEVHAFI--------RKLLSEMYDEETAGSIRILYGGSIKP---DNFLG
2c6qB           EMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAF
1chrA           NQAWDEQVASVYIPELEALGVELI-------EQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDL-
2agkA           WQTLTDLELNADTFRELRKYTNEFLIHAGGIDE---LLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVD
2dzvA           ------NTPAERLKVIDDMTTGFVYLVSLYGTEEIPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
3b8iA           AELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY--GNPQLRDDA
2csbA           PAIEVRAVKRNPLQPALYRILVRYGRVDLPVTVDEVPPEAGEFERLIERYDVPIDE--------------
1al8A           CRSLKEISRSHIAADWD-----------------------------------------------------
3dtvD           A-RVDTATLVDLCVRAFEAAPDS--------DGILLSLTLDAIPEVERRLGVPVVSSSPAGFWDAVRLAG
2bdqA           AFDVIPKSDQKKSIDQLVALGFTRILLHGSSNGEPIIENIKHKALVEYANNRIEIVGGGVTAENYQYIC-
1dbtA           LIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVSPSFLTVTPGIRMSEDAANDQVRVATPAIAR
2e68B           ----------------------------------------------------------------------
1b3oB           AKSLTRAMMYSGELKFEKRTSSA-----------------------------------------------
2a7rB           EMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAF
3bw4A           -------------------GGHQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGGIMRGGQIAAV-
1eepB           LKDILTQLKGGLMSGMGYLGAATI--SDLKINSKF-----------------------------------
3bpwB           LSLDNKQAYVIMAQEALNMSSYLNLEQNNEFIGFVVGANRTYFPNCYILSPGIGAQNGDLHKTLTNGYHK
2b4gA           ----------------------------------------------------------------------
3b8iB           AELIDVDAVIQRTLAYQEAGADGICLVGVR--------DFAHLEAIAEHLHIPLMLVTY--GNPQLRDDA
3cepA           IFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLAAPALQGFGISS---PEQVS
2dqwB           VVAEVKAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDVALGHPVLVGLSRKRTI------
3eb2D           VASTSVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIESYFRAIADAVEIPVVIYTNPQFQRSDLTLD
3eisB           MARVDTATLVDLCVRAFEAAPDS--------DGILLSLTLDAIPEVERRLGVPVVSSSPAGFWDAVRLAG
2bwgB           GKTVEVPYKGDVENTILDIL--GGLRSTCTYVGAAKLKELSRRATFIR----------------------
3bw2A           -------------------GGHQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGGIMRGGQIAAV-
2a7rD           EMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAF
1c29A           ICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAV
2dzwB           ----------------------------------------------------------------------
3c3nA           VKTI------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
2cu0A           MKTRKFVPEGVEGVVPYRGTVSEVLYQLVGLKAGMGYVGARNIRELKEEFVIITHAGIKESHPHDII---
2dzsA           ----------------------------------------------------------------------
1al7A           CRSLKEISRSHIAADWD-----------------------------------------------------
2dzxB           ----------------------------------------------------------------------
2dp3A           EVVIAYEPVWSIGTGVVATPEQAEEVHVGLRKWFVEKVAA------EGAQHIRIIYGGSANGSNCEKL--
2dzsB           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
2du2A           VEDLKGLDLF------------------------------------------------------------
2a7rA           AGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCT-------------------------------
3dfhA           HERLFPNQAIQFAKEVEQYKPYFIEDILPPNQ-------TEWLDNIRSQSSVSLGLGELFNNPEEWKSLI
1b3oA           AKSLTRAMMYSGELKFEKRT--------------------------------------------------
3bw3A           -----------IAQGVEA-GGDQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAAGGIMRGGQIAAV-
1bwlA           AETGIVAQYAYVAGELEKRAKAGKRLTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVRE-
2e09B           ----------------------------------------------------------------------
2dzpB           VFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTEEPKTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
2dztB           ----------------------------------------------------------------------
3b8iE           AELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY-----------
3bi8A           TGSNNTAASIAMSKWAESIGVDGLLVITPYYNKTTQKGLVKHFKAVSDAVSTPIIIYNVPGRTGLNITPG
1ak5A           LKDNVEASLNKVKSTMCNCGALTI--PQLQSKA-------------------------------------
2dzvB           VFLAAPNTPAERLKVIDDMTTGFVYLVSLYGTTEEIPTAYDLLRRAKRICRNKVAVGFGVSKREHVVSLL
3d0cB           YS---VDTAIELGKSAIDSGADCVIHQPVHPYITDAGA-VEYYRNIIEALDAPSIIYFKDAHLSDDVIKE
2djxA           ----------------------------------------------------------------------
2djlA           VKTI------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
2e77B           VEDLKGLDLF------------------------------------------------------------
3barA           LSLDNKQAYVIMAQEALNMSSYLNLEQNNEFIGFVVGASYDEMNYIRTYFPNCYILSPGIGDLHKTLTNG
2bwgD           ASEGKTVEVPYKGDVEN-----------------------------------------------------
1btmA           ----------------------------------------------------------------------
2ehhC           TGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNI-----------
2dqwA           RYRDVVAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELS
2btmA           ----------------------------------------------------------------------
2bbfA           ----------------------------------------------------------------------
2ehhA           TGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVD
2dzbA           VVAEVKAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELS
2bwgA           MVEELILSGAD-IIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAF
3di1A           TGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPE
3c6eA           ----------------------------------------------------------------------
2e77C           VEDLKGLDLF------------------------------------------------------------
3dtvC           MARVDTATLVDLCVREAAPDSDGILLSCGG------LLTLDAIPEVERRLGVPVVSSSPA----------
3bllA           ----------------------------------------------------------------------
3dz1A           IRQIVDSASCVLKHEDWPGLRGFQKDGSLRPLSILCGNGGLFLDFEERGADGATGYCFPDL---------
1bksA           ALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALPLHHLIEKLKEYHAAPALQGFGISS---PEQVS
1bkhA           NQYWDESQAIRACQVLGDNGIDLI-------EQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLA
3ddmA           NQGWDLPRARQMAQRLGPAQLDWL------EEPLRADRPAAEWAELAQAAPMPLAGGENIAGVAAFETA-
1bwkA           AETGIVAQYAYVAGELEKRAKAGKRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVRE-
2clhA           IFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGH-----HLIEKLKEYHAAPALQGFGISSPEQVSAAV
3daqA           TGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLTNMTIEPETVEILS
2e77A           VEDLKGLDLF------------------------------------------------------------
2cu0B           MKTRKFVPEGVEGVVPYRGTVSEVLY--------------------------------------------
1dvjA           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
3eezA           NRGWTRQQALRVMRATEDLHVMFE----------QPGETLDDIAAIRPLHSAPVSVDECLVTLQDAARV-
2bznB           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
3c5xA           LDFELIKTEAKQPATLRKYCIEAKLTNTTTESQDKRFVCKHSMVDRGWGNGCGLFGKGGIVT---CAMFR
1eepA           LKDILTQLKGGLMSGMGYLGAATI----------------------------------------------
3b8iD           AELIDVDAVIQRTLAYQEAGADGICLVGV--------RDFAHLEAIAEHLHIPLMLVTY-----------
3dgbA           NQAWDEAVALRACRILGGNGIDLI-------EQPISRNNRAGMVRLNASSPAPIMADESIECVEDAFNL-
3bggA           ----------------------------------------------------------------------
3e7sA           WGKLQVFDARDCSSAQEMNHIKYATNRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGD
3eahB           WGKLQVFDARDCRSAQEMFTYICNHIKYATNRGITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGD
1dvjC           ----------------------------------------------------------------------
3dtvB           MARVDTATLVDLCVRAAAPDSDGIL---LSCGGLL---TLDAIPEVERRLGVPVVSSSPA----------
3c6eA           LDFELIKTEAKQPATLRKYCIEAKLTNTTTESQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFRCKK


                         .         .         .         +         .         .         .:280
query           QHEQDGIGGAIIGRALYEEKIQLAEALAIAKRLSGESTx
3bolB           YYNTAFLVLGISKGLMNPLDETLMKTLNATLVILEK---
2cffA           KVHTETNGGVIVGRAFLEGILTVEVMKRYAR--------
2a0nA           EAFLAGADAALAASVFHFREIDVRELKEYLKKHG-----
2e7fA           -QNRPLINRTFLAMAMA----------------------
3bofB           SYYNTAFLGISKGLSSAPLDETLMKTLNATLVILEK---
1beuA           RAGAAGISGSAIVKIIEKNLASPKQMLA-----------
3dg9A           GGAKARPGYGRL---------------------------
2a1yA           RFGATMVM-------------------------------
3c4uA           KSYLDAGGDLKGSKGVPFEFLQESVKGGINK--------
3cu2A           TH---QIDWLVSGSALFSGELKTN---------------
1ad1B           ---------------------------------------
3bofA           SYYNTGISKGLSSAIMNPLDETLMKTLNATLVILEK---
1ad4B           GYDTTPVERDEVTAATTAYGIM-----------------
1dquA           ---------------------------------------
2a7rC           GAGADFVM-------------------------------
2dzuA           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
2dzpA           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
1a50A           ---RAGAAGAISGSAIVKIIEKNLASPQMLAELRS----
3eb2B           VIARLAEHPRIRYIKDASTNTGRLLSII-----------
2ekcB           SFDGVVVGSALVKLAGQKKIEDLGNLVKELK--------
2dzbB           PAQRVHGSVAAHLFAV-----------------------
2dztA           KEGANGV---VVGSALV----------------------
2c3zA           KL---GVNAFLIGSSLMRNPEKIKEFI------------
1dbtB           EKGSSAI---VVGRSITKAEDPVKAYKAVRLEWEG----
2dzuB           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
2e09A           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
2aqwA           DYEKLLI---NVGRAITKSPDPKKSSESYYNQI------
2e28A           ---------------------------------------
2c6qA           GAGADFVMLG-----------------------------
2dzxA           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
3c61A           ---------------------------------------
1a53A           KLGVNAF---LIGSSLMRNPEKIKEFI------------
3b5vA           ALGVNAF---SIHSSLMRNPEKIKEFI------------
2bleA           ---------------------------------------
3ct7A           AA---GADVFIVGTSGLFNHAENIDEAW-----------
2a7nA           ALGAEAYGLAARGETGVDEVLTLKADIDRTLAQIGCPD-
1b9bA           LIVQKDIDGGLVGGASLK---------------------
2c6qB           GAGADFVMLG-----------------------------
1chrA           -ARDRSVDVFSLKLCNMGGVSATQKIAAVAE--------
2agkA           ELSH-GKVDLTFGSSLD----------------------
2dzvA           KEGANGVGSALVKIIGEKGREATEFLKKKVEELLG----
3b8iA           RLARLGVRGHAAYFAAIKATYDCLREER-----------
2csbA           ---------------------------------------
1al8A           ---------------------------------------
3dtvD           GGAKARP---GYGRLFDE---------------------
2bdqA           ---QETGVKQAHGTRI-----------------------
1dbtA           EKGSSAI---VVGRSITKAEDPVKAYKAVRLEWEG----
2e68B           ---------------------------------------
1b3oB           ---------------------------------------
2a7rB           GAGADFVM-------------------------------
3bw4A           ---------------------------------------
1eepB           ---------------------------------------
3bpwB           SYEKILI---NIGRAITKNPYPQKAAQMYYDQI------
2b4gA           ---------------------------------------
3b8iB           RLARLGVRGHAAYFAAIKATYDCLREER-----------
3cepA           AAVRAGAAGAISGSAI-----------------------
2dqwB           ---------------------------------------
3eb2D           VIARLAEHPRIRYIK--DASTNTGRLLSIINRCGDA---
3eisB           GGAKARPGYG-----------------------------
2bwgB           ---------------------------------------
3bw2A           ---------------------------------------
2a7rD           GAGADFV--------------------------------
1c29A           ---RAGAAGAISGSAIVKEKNLASPKQMLAE--------
2dzwB           ---------------------------------------
3c3nA           ---------------------------------------
2an2A           ---------------------------------------
2cu0A           ---------------------------------------
2dzsA           ---------------------------------------
1al7A           ---------------------------------------
2dzxB           ---------------------------------------
2dp3A           -GQCPNIDGFLVGGASL----------------------
2dzsB           ---------------------------------------
2dzwA           ---------------------------------------
2abbA           ---------------------------------------
2du2A           ---------------------------------------
2a7rA           ---------------------------------------
3dfhA           ANRRDFIRSQIGGITPALKLGHLCQNFGVRIAWHCPP--
1b3oA           ---------------------------------------
3bw3A           ---------------------------------------
1bwlA           -EVKDKRTLIGYGRFFI----------------------
2e09B           ---------------------------------------
2dzpB           KEGANGV---VVGSALVKIIGEKGREAT-----------
2dztB           ---------------------------------------
3b8iE           ---------------------------------------
3bi8A           TLKELCEDKNIVAVKEA----------------------
1ak5A           ---------------------------------------
2dzvB           KEGANGVGSALVKIIGEKGREATEFLKKKVE--------
3d0cB           LAPLDKLVGIKYAINDIQRVTQVRAVPK-----------
2djxA           ---------------------------------------
2djlA           ---------------------------------------
2b4gB           ---------------------------------------
2e77B           ---------------------------------------
3barA           YHKSYEKILINIGRAITKNPYPQKAAQMYYDQI------
2bwgD           ---------------------------------------
1btmA           ---------------------------------------
2ehhC           ---------------------------------------
2dqwA           GAQRVHGSVAAHLFAV-----------------------
2btmA           ---------------------------------------
2bbfA           ---------------------------------------
2ehhA           TMFKLASEENIVASKES----------------------
2dzbA           ---------------------------------------
2bwgA           GAGADFVM-------------------------------
3di1A           TVEILSQHPYIVALKDA--TNDFEYLEEVKKRIDTN---
3c6eA           ---------------------------------------
2e77C           ---------------------------------------
3dtvC           ---------------------------------------
3bllA           ---------------------------------------
3dz1A           ---------------------------------------
1bksA           AAVRAGAAGAISGSAI-----------------------
1bkhA           --ADGAASIFALKIAKNGGPRAVLRTAQIAEA-------
3ddmA           -LAARSLRVMQPDLAKW----------------------
1bwkA           -EVKDKRTLIGYGRFFI----------------------
2clhA           ---RAGAAGAISGSAIVK---IIEKNLA-----------
3daqA           QH--PYIVALKDATNDFEYLEEVKKRID-----------
2e77A           ---------------------------------------
2cu0B           ---------------------------------------
1dvjA           ---------------------------------------
2e68A           ---------------------------------------
3eezA           -ARDGLAEVFGIKLNRV---GGLTRAARMRD--------
2bznB           ---------------------------------------
1efzA           ---------------------------------------
3c5xA           CKKNMEGKVVQPENLEYTIVITPHSG-------------
1eepA           ---------------------------------------
3b8iD           ---------------------------------------
3dgbA           -AREGAASVFALKIAK-----------------------
3bggA           ---------------------------------------
3e7sA           PANVEITE---LCIQHG----------------------
3eahB           PANVEITELC-----------------------------
1dvjC           ---------------------------------------
3dtvB           ---------------------------------------
3c6eA           NMEGKVV---QPENLEYTIVITPHSG-------------