[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA59517.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3a5cD.bssp"
#ERROR : Can't open dsspfile "2ck3A.bssp"
#ERROR : Can't open dsspfile "2ck3D.bssp"
#ERROR : Can't open dsspfile "2ck3E.bssp"
#ERROR : Can't open dsspfile "2ck3B.bssp"
#ERROR : Can't open dsspfile "2ck3F.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3a5cA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3dsrA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1e79D.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3c9iA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2efwG.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3bihA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1cliA.bssp"
#ERROR : Can't open dsspfile "2ba3A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2a7uA.bssp"

## Summary of PDB Search
:515
    e-108  24%  3a5cD  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    e-108  60%  2ck3A  [b.49.1 - c.37.1 - a.69.1 (1bmfA)] ATP SYNTHASE ALPHA CHAIN
    e-107  21%  2ck3D  [b.49.1 - c.37.1 - a.69.1 (1bmfD)] ATP SYNTHASE BETA CHAIN
    e-107  21%  2ck3E  [x.x.x] ATP SYNTHASE BETA CHAIN
    e-105  59%  2ck3B  [b.49.1 - c.37.1 - a.69.1 (1w0jB)] ATP SYNTHASE ALPHA CHAIN
    5e-99  21%  2ck3F  [b.49.1 - c.37.1 - a.69.1 (1bmfE)] ATP SYNTHASE BETA CHAIN
    6e-87  23%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-84  23%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-83  18%  3a5cA  [x.x.x] V-TYPE ATP SYNTHASE ALPHA CHAIN
    4e-82  23%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-80  24%  3dsrA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-76  59%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-69  21%  1e79D  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE BETA CHAIN
    4e-60  55%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    7e-59  60%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    9e-50   8%  3c9iA  [x.x.x] TAIL NEEDLE PROTEIN GP26
    4e-38  11%  3cmuA  [x.x.x] PROTEIN RECA
    6e-37  21%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-35  12%  2efwG  [x.x.x] REPLICATION TERMINATION PROTEIN
    9e-34  10%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    9e-31  11%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-30  22%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-30  12%  3cmwA  [x.x.x] PROTEIN RECA
    2e-29  10%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    9e-25  21%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-23  16%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-23  20%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-19  17%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-19  12%  3cmwC  [x.x.x] PROTEIN RECA
    5e-19  13%  3cmxA  [x.x.x] PROTEIN RECA
    8e-19   9%  3bihA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    3e-18  12%  3cmtD  [x.x.x] PROTEIN RECA
    5e-13  14%  3cmvB  [x.x.x] PROTEIN RECA
    1e-11  18%  1cliA  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    7e-11  16%  2ba3A  [x.x.x] NIKA
    2e-09  18%  3cmvA  [x.x.x] PROTEIN RECA
    7e-09  13%  3cmvH  [x.x.x] PROTEIN RECA
    4e-06  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-04  13%  3cmvG  [x.x.x] PROTEIN RECA
    4e-04  12%  3cmvE  [x.x.x] PROTEIN RECA
    4e-04  60%  2a7uA  [x.x.x] ATP SYNTHASE ALPHA CHAIN
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
3a5cD           ------------------------------GAIVDIKDGTGRVRG------GQVIEVSEEYAVIQVFEET
2ck3A           -------------------------DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3D           ----------------------------TTGRIVAVIGAVVDVQFDPPILNALEVQGRETRLVLEVHLGE
2ck3E           ----------------------------TTGRIVAVIGAVVDVQFDPPILNALEVQGRETRLVLEVHLGE
2ck3B           ---------------------------EETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3F           ----------------------------TTGRIVAVIGAVVDVQFDPPILNALEVQGRETRLVLEVHLGE
3dsrB           ------------------------------------AGPLIFVEKTEPVGYNEIVNIKMGDRGQVLDSSA
2dpyA           ---------------------------RRYGRLTRATGLVLEATGL-QLPLGATCIIERQDESEVVGFNG
3a5cA           ---GLVGEIIRLDGDTAFVQVYEDTSGLKVGEPVVS-TGLPLAVELGPGMLNGIYDGIQRPLVHALDREK
2dpyB           -------------------------AVRRYGRLTRATGLVLEATGL-QLPLGATCIITKEVESEVVGFNG
3dsrA           ---------------------------------------LIFVEKTEPVGYNEIIKMGDGTVRRGQVLDS
1e1qB           -------------------------DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1e79D           ----------------------------TTGRIVAVIGAVVDVQFDPPILNALEVQGRETRLVLEVHLGE
1bmfC           ----------------------ADTSVEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
2ck3C           -------------------------DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
3c9iA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3b2qA           ------------------------------------AGPLIFVEKTEPVGYNEIVNI-------KMGDGT
2efwG           ----------------------------------------------------------------------
1d6nA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2c61A           ------------------------------------------------LIFVEKTEPVGYNEIVNIKMGD
3cmwA           ----------------------------------------------------------------------
1bzyA           ----------------------------------------------------------------------
2c61B           ---------------------------------------LIFVEKTEPVGYNEIVNI--------KMGDG
3eiuB           ---------------------------------------LIFVEKTEPVGYNEIVNI--------KMGDG
3eiuA           ------------------------------------------------LIFVEKTEPVGYNEIVNIKMGD
3b2qB           -------------------------------------GPLIFVEKTEPVGYNEIVNI-----KMGDGTVR
3cmwC           ----------------------------------------EGINFYGELVDLGVKEKLIEKAGAWYSYKG
3cmxA           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
3cmtD           -----------------------------------------------------------------YSYKG
3cmvB           ----------------------------------------------------------------------
1cliA           -----------------------------VDTASAVISGIAEGCLQSGLVGGETAEMPGMYHGEDYDVAG
2ba3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2a7uA           --MQLNSTEISELIKQRIAQFN------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT
3a5cD           TGLDL----------ATTSVSLVEDVARLGVSKEMLGRRFNGIGKPIDGLPPITPEKRLPITGLPLNPVA
2ck3A           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3D           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
2ck3E           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
2ck3B           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3F           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
3dsrB           DIVV---------VQVFEGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2dpyA           QRLFLMPLEEVEGILPGAR---VYARKQLPLGPALLGRVLDGGGKPLDGLPAPDTLETGALITPPFNPLQ
3a5cA           KWAWTPMVKPGDEVRGGMVVPEFGFTHKILVPPDVRGRVKEVKPAGEYTVTELKMYHTWPVRR-ARPVQR
2dpyB           QRLFLMPLEEVEGILPGAR-VYARSGKQLPLGPALLGRVLDGGGKPLDGLPAPDTLETGALITPPFNPLQ
3dsrA           SA-DIVVVQVFEGI-------FTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
1e1qB           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1e79D           STVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
1bmfC           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
2ck3C           DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
3c9iA           ----------------------------------------------------------------------
3cmuA           ---------------------------------------------KALAAALGQIEKQFGKGSIMRLGED
3b2qA           VRRGQVLDSSADIVVVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
2efwG           ----------------------------------------------------------------------
1d6nA           -SPGVVISDDEPGYDLDLFCIYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLAGGYKFFA
3bs4A           ----------------------------------------------------------------------
2c61A           GTVRRGQVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3cmwA           ---------------------------------------------------------------IMRLGED
1bzyA           -SPGVVISDDEPGYDLDLFCIPNHYLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFA
2c61B           TVRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3eiuB           TVRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3eiuA           GTVRRGQVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3b2qB           RGQVLDSSADIVVVQVFEGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA
3cmwC           EKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDENKQKALAAALGQIEKQFGKGSIMRLGED
3cmxA           -----------AWLKDNPETAKEIEKKVRELLLSNPNSAIDENKQKALAAALGQIEKQFGKGSIMRLGED
3bihA           ----------------------------------------------------------------------
3cmtD           EKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDENKQKALAAALGQIEKQFGKGSIMRLGED
3cmvB           ----------------------------------------------------------------------
1cliA           FCVGVVEKSDGSKVSDGDVLIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKPLADHLLA--PTRIY
2ba3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------GQIEKQFGKGSIMRLGED
3cmvH           -----------------------------------------------------QIEKQFGKGSIMRLGED
3dvlD           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------GQIEKQFGKGSIMRLGED
3cmvE           ------------EKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKAALGQIEKQFGKGSIMRLGED
2a7uA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
3a5cD           RRKPEQFIQTGISTIDVMNTLVRGQKLPIFSGSGLPANEIAAQATVRPKEEPFAVVFAAMGITQRELSYF
2ck3A           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKKKKLYCIYVAIGQKRSTVAQL
2ck3D           MSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAGGYSVFAGVGERTREGNDL
2ck3E           MSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAGGYSVFAGVGERTREGNDL
2ck3B           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKKKKLYCIYVAIGQKRSTVAQL
2ck3F           MSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAGGYSVFAGVGERTREGNDL
3dsrB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIAVPGSESAFAVVFAAMGITNEEAQYF
2dpyA           RTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRAD--VIVVGLIGERGREVKDF
3a5cA           KLDPNTPFLTGMRILDVLFPVAMGGTAAIPGPFGSGKTVTQ-QSLAKWSNADV-VVYVGCGERGNEMTDV
2dpyB           RTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRAD--VIVVGLIGERGREVKDF
3dsrA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQASVPGSESAFAVVFAAMGITNEEAQYF
1e1qB           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGCIYVAIGQKRSTVAQL
1e79D           MSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAAHGGYSVFAGVGERTREGNDL
1bmfC           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQ
2ck3C           RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKKKKLYCIYVAIGQKRSTVAQL
3c9iA           ------------------------------------------------------LNNPVVIQATRLDASI
3cmuA           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL------
3b2qA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEE
2efwG           ----------------------------------------------------------------------
1d6nA           DLLDYIKALNRNSDRSIPMTVDFIRLGSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTL
3bs4A           -------LSWEIEELDREIGKIHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFLIIRILSRFGVD
2c61A           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGFAVVFAAMGITNEEAQYF
3cmwA           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL------
1bzyA           DLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTL
2c61B           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGFAVVFAAMGITNEEAQYF
3eiuB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGFAVVFAAMGITNEEAQYF
3eiuA           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGFAVVFAAMGITNEEAQYF
3b2qB           RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV---------F
3cmwC           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI---
3cmxA           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD-----
3bihA           -------------------------------RRELAIEFSRVTESAALAGYK----WLGRGDKNTADGAA
3cmtD           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI---
3cmvB           -----------------------GRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP----
1cliA           VKSVLELIEKVD--VHAIAHLTGG----------------------------------------------
2ba3A           -------------------------------------------------------------------DSA
3cmvA           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI---
3cmvH           RSMDVETISTGSLSLDIALGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI---
3dvlD           -----AKMRTMIEGFDDISGLPIGRSTLVSGTSGTGKTLFSIQFLYNIIEFDEPGVFVTFEETPQDIIKN
3cmvG           RSMDVETISTGSLSLDIALGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAF-----IDAEHALD
3cmvE           RSMDVETISTGSLSLDIALGAGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAF-----IDAEHALD
2a7uA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
3a5cD           IQEFERTGALSRSVLFLNKADDPTIERILTPRMALTVAEYLAEHDYHVLVILTDMTNYCEALREIGAARE
2ck3A           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3D           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2ck3E           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
2ck3B           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3F           YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
3dsrB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYHGMHVLVILTDITNYAEALRQMG----
2dpyA           IENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIG
3a5cA           LVEKTGGPLMHRTVLIANTSNMPVAAREASIYVGVTIAEYFRDQGFSVALMADSTSRWAEALREISSRLE
2dpyB           IENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIG
3dsrA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAEHGMHVLVILTDITNYAEALRQM-----
1e1qB           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1e79D           YHMIESKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQGQDVLLFIDNIFRFTQAGSEVSALLG
1bmfC           KRSAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSDNGKHALIIYDDLSKQAVAYRQMSLLLR
2ck3C           VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
3c9iA           LPRNVFSKSYLLYVIAQGTDVGAIAGKANEAVKNDEQDVELADHEARIKQLRIDVDDHESNTKAITALNV
3cmuA           DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEMGLAARMMSQAMR
3b2qA           AQYFKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARN
2efwG           ----------------------------------------------------------------------
1d6nA           LSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVGYALDYNEYFRDLNHVC-----------
3bs4A           VIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSS---ETLPIKYAKAVEDHKKVWMDLNLFEGRELYGF
2c61A           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEGMHVLVILTDITNYAEALRQMGAARN
3cmwA           DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEMGLAARMMSQAMR
1bzyA           LSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVGYALDYNEYFRDLNHVCVKYK-------
2c61B           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLYEHGMHVLVILTDITNYAEALRQMGYPGY
3eiuB           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAAG
3eiuA           MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGPGY
3b2qB           AAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDIT
3cmwC           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bihA           VNAMRNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAV---LAV
3cmtD           ----------------------------------------------------------------------
3cmvB           --IYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPLAARMMSQAMRKLAGNLK
1cliA           ----------------------------------------------------------------------
2ba3A           VRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN-----------------------
3cmvA           ----------------------------------------------------------------------
3cmvH           --YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKL
3dvlD           ARSFGWD------------------LAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINY--AIQK
3cmvG           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKL
3cmvE           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKL
2a7uA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
3a5cD           EIPGRRGYPGYMYTDLATIYERA-------------GVVEGKKGSVTQIPILSMPDDDRTHPIPDLTGYI
2ck3A           RPPGREAYPGDVFYLHSRLLERAAKMN-----------DAFGGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3D           RIPSAVGYQPTLATDMGTMQERIT---------------TTKKGSITSVQAIYVPADDLTDPAPATTFAH
2ck3E           RIPSAVGYQPTLATDMGTMQERIT---------------TTKKGSITSVQAIYVPADDLTDPAPATTFAH
2ck3B           RPPGREAYPGDVFYLHSRLLERAAKM-----------NDAFGGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3F           RIPSAVGYQPTLATDMGTMQERIT---------------TTKKGSITSVQAIYVPADDLTDPAPATTFAH
3dsrB           --AARRGYPGYMYTDLATLYERAGIVK-------------GAKGSVTQIPILSMHP------IPDLSGYI
2dpyA           EPPATKGYPPSVFAKLPALVERA-------------GNGIHGGGSITAFYTVLTEGDDQQDPIADSARAI
3a5cA           EMPAEEGYPPYLAARLAAFYERAGKVI----------TLGGEEGAVTIVGAVSPPGGDMSEPVTQSTLRI
2dpyB           EPPATKGYPPSVFAKLPALVERA-------------GNGIHGGGSITAFYTVLTEGDDQQDPIADSARAI
3dsrA           ------GAPGYMYTDLATLYERAGIVK-------------GAKGSVTQIPILSMPP------IPDLSGYI
1e1qB           RPPGREAYPGDVFYLHSRLLERAAKMNDAFGGG-----------SLTALPVIETQAGDVSAYIPTNVISI
1e79D           RIPSAVGYQPTLATDMGTMQERIT---------------TTKKGSITSVQAIYVPADDLTDPAPATTFAH
1bmfC           RPPGREAYPGDVFYLHSRLLERAAKMNDAF-----------GGGSLTALPVIETQAGDVSAYIPTNVISI
2ck3C           RPPGREAYPGDVFYLHSRLLERAAKMNDAFGGG-----------SLTALPVIETQAGDVSAYIPTNVISI
3c9iA           RVTTAEGEIASLQTNVSALDGRVTTAENN-----------ISALQADYVSKTATTSQSLASPLNVTTSYS
3cmuA           KLAGNLKQSNTLLIFIN-----------------------------QIRNPETTTGGNALKFYASVRLDI
3b2qA           EVPGRRGYPGYMYTDL-------------ATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
2efwG           ----------------------------------------------------------------------
1d6nA           ----------------------------------------------------------------------
3bs4A           AISMSGYLEVFTPEETLRYLETSAEVRY----------GHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRR
2c61A           EVPGRRGYPGYMYTDLAT-LYERAGIVKGAKGSVTQI------------PILSMPGDDITHPIPDLSGYI
3cmwA           KLAGNLKQSNTLLI-----------------------------FINQIRNPETTTGGNALKFYASVRLDI
1bzyA           ----------------------------------------------------------------------
2c61B           MYTDLATLYERAGIVKGAKGSV------------------------TQIPILSMPGDDITHPIPDLSGYI
3eiuB           YPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGY--------ITEGQIVVARELH
3eiuA           ------------------------MYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
3b2qB           NYAEALR--------QMGRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI
3cmwC           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bihA           GDKGCFLNAPDMYMEKLIVGPGAKGTLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVF
3cmtD           ----------------------------------------------------------------------
3cmvB           QSNTLLIF----INQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK---IAAPFKQAEFQI
1cliA           ----------------------------------------------------------------------
2ba3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvH           AGNLKQSNTLLIFNQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQAEF
3dvlD           YRARRVSI--DSVTSVFQQYDASSVVRRELFRLVARLKQIGA----TTVMTTERIEEYGPIARYGVEEFV
3cmvG           AGNLKQNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK--IAAPFKQAEFQIL
3cmvE           AGNL------------------------------------------------------------------
2a7uA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
3a5cD           TEGQIQLSRELHRKGIYPPIDPLPSLSRVGKGKTREDHKQVSDQLYSAYANGVDIRKLVAIIDALTENDR
2ck3A           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2ck3D           LDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHDVARGVQKILQDYKSLQDIIAIMDELSEEDK
2ck3E           LDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYVARGVQKILQDYKSLQDILSEEDKLTVSRA
2ck3B           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYRE--------VALDAATQ
2ck3F           LDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHDVARGVQKILQDYKSLQDIIAIMDELSEEDK
3dsrB           TEGQIVVARELHRKGIYPPINVLPSLSRIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIKEALSERDT
2dpyA           LDGHIVLSRRLAEAGHYPAIDIEASISRAMTALITEQHYARVRLFKQLLSSFQRNRDLVSVAKGSDPMLD
3a5cA           VGAFWRLDASLAFRRHFPAINWNGSYSLFTSALDPWYRENVADAISELLQREAGLQEIVQLVGPDALQDA
2dpyB           LDGHIVLSRRLAEAGHYPAIDIEASISRAMTALITEQHYARVRLFKQLLSSFQRNRDLVSVAKGSDPMLD
3dsrA           TEGQIVVARELHRKGIYPPINVLPSLSRIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVEALSERDT
1e1qB           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYRE--------VALDAATQ
1e79D           LDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGEHYDVARGVQKILQDYKSLQDIIAILDELSEEDK
1bmfC           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
2ck3C           TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
3c9iA           VGGKKVVATGTANKGVFDADLTFAVSDTYTQSEIQAIANA----LITERRRTKAMEDALRA---------
3cmuA           RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGNFYGELVDLGVKEKLIEKAGAWYSYKGE
3b2qA           TEGQIVVARELHRKGIYPPINVLPSLSRIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVEALSERDT
2efwG           -------------------------------------------------TGF-LVKQRAFLKLYMITMTE
1d6nA           ----------------------------------------------------------------------
3bs4A           ADYVLKTRSSLGENGIKRELL-------------------------------------------------
2c61A           TEGQIVVARELHRKGIYPPINVLPSLSRIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGALSERDT
3cmwA           RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINYGELVDLGVKEKLIEKAGAWYSYKGE
1bzyA           ----------------------------------------------------------------------
2c61B           TEGQIVVARELHRKGIYPPINVLPSLSSGIGAGKTREDHKAVSDMYAGYAEGRDLRGLVAIVEALSERDT
3eiuB           RKGIYPPINVLPSL-SRLM-------NSGIGAGKTREDHKAVDQMYAGYAEGRDLRGLVAIVGALSERDT
3eiuA           TEGQIVVARELHRKGIYPPINVLPSLSRLMAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGKLSERDT
3b2qB           TEGQIVVARELHRKGIYPPINVLPSLSRL---MNSGIGAGKTREMYAGYAEGRDLRGLVAIVGALSERDT
3cmwC           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bihA           AIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKNEENRRIGEQELA
3cmtD           ----------------------------------------------------------------------
3cmvB           LYGEG---INFYGELVDLGVKEK--LIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAK---EIEKKVR
1cliA           ----------------------------------------------------------------------
2ba3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvH           QILYG-----------------------------------------------------------------
3dvlD           SDNVVILRNVLEGERRRRTLE-------------------------------------------------
3cmvG           YGEGI-----------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2a7uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITK
3a5cD           RYLQFADAFERFFINQGQQNRSIEESLQIAWALPQGELKRISKDHIGKY---------------------
2ck3A           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2ck3D           LTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKG------FQQILAGEYDHLPEQAFYMVGPIEE
2ck3E           RKIQRPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPAVAKADKLA----------
2ck3B           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2ck3F           LTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKEGEYDHLPEQAFYMVGP-------------------
3dsrB           KFLEFADLFEDFVRQGRNENRTIEDTLEIG----WQILTHLPENQLGRIDNKYIQKYHPAH---------
2dpyA           KAITLWPQLEAFLQQGIFERADWEDSLQALDL--------------------------------------
3a5cA           ERLVGRIIREDFLQQNAYHEVDAYCSMKKAYGIMKMILAFYKEAEAAIKRGVSIDEILQL--PVLERIGR
2dpyB           KAITLWPQLEAFLQQGIFERADWEDSLQALDL--------------------------------------
3dsrA           KFLEFADLFEDFVRQGRNENRTIEDTLEIGW----QILTHLPENQLGRIDNKYIQKYHPAH---------
1e1qB           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
1e79D           LTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKET------IKGFQQILAGEYDHLPEQAFYMVGPIEE
1bmfC           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
2ck3C           QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
3c9iA           ----------------------------------------------------------------------
3cmuA           KIGQGKANATAWLKDNPETAKEI-----------------------------------------------
3b2qA           KFLEFADLFEDFVRQGWNENRTIEDTLEIG----WQILTHLPENQLGRIDNKYIQKYHPAH---------
2efwG           QERLYGLKLLEVLRS-EFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKEVVLYQFKDYEAAKLYKKQ--
1d6nA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2c61A           KFLEFADLFEDFVRQGRNENRTIEDTLEIGW----QILTHLPENQLGRIDNKYIQKYHPAH---------
3cmwA           KIGQGKANATAWLKDNPETAKEI-----------------------------------------------
1bzyA           ----------------------------------------------------------------------
2c61B           KFLEFADLFEDKFRQGRNENRTIEDTLEIG----WQILTHLPENQLGRIDNKYIQKYHPAHRKA------
3eiuB           KFLEFADLFEDFVRQGWNENRTIEDTLEIG----WQILTHLPENQLGRIDNKYIQKYHPAH---------
3eiuA           KFLEFADLFEDFVRQGWNENRTIEDTLEIG----WQILTHLPENQLGRIDNKY-----------------
3b2qB           KFLEFADLFEDFVRQGWNENRTIEDTLEIG----WQILTHLPENQLGRIDNKYIQKYHPAHRKA------
3cmwC           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bihA           RCKAMGIEAGKVLRL---GDMARSDNVIF-----------------------------------------
3cmtD           ----------------------------------------------------------------------
3cmvB           ELL-------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
2ba3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2a7uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TGDYSDEIAAELRAAIENFKTTxxx
3a5cD           -------------------------
2ck3A           DGKISEESDAKLKEIVTNFLAG---
2ck3D           AVAKADKLA----------------
2ck3E           -------------------------
2ck3B           DGKISEESDAKLKEIVTNFLAG---
2ck3F           -------------------------
3dsrB           -------------------------
2dpyA           -------------------------
3a5cA           ARYVSEEFPAYFEEAMKEIQGA---
2dpyB           -------------------------
3dsrA           -------------------------
1e1qB           DGKISEESDAKLKEIVTNFLAG---
1e79D           AVAKADKLA----------------
1bmfC           DGKISEESDAKLKEIVTNFLAG---
2ck3C           DGKISEESDAKLKEIVTNFLAG---
3c9iA           -------------------------
3cmuA           -------------------------
3b2qA           -------------------------
2efwG           ---LKVELDRSKKLIEKALSDN---
1d6nA           -------------------------
3bs4A           -------------------------
2c61A           -------------------------
3cmwA           -------------------------
1bzyA           -------------------------
2c61B           -------------------------
3eiuB           -------------------------
3eiuA           -------------------------
3b2qB           -------------------------
3cmwC           -------------------------
3cmxA           -------------------------
3bihA           -------------------------
3cmtD           -------------------------
3cmvB           -------------------------
1cliA           -------------------------
2ba3A           -------------------------
3cmvA           -------------------------
3cmvH           -------------------------
3dvlD           -------------------------
3cmvG           -------------------------
3cmvE           -------------------------
2a7uA           -------------------------