[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for noce0:ABA59518.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1abvA.bssp"
#ERROR : Can't open dsspfile "2bo5A.bssp"

## Summary of PDB Search
:178
    2e-21  32%  1abvA  [x.x.x] DELTA SUBUNIT OF THE F1F0-ATP SYNTHASE
    2e-20  19%  2bo5A  [x.x.x] ATP SYNTHASE OLIGOMYCIN SENSITIVITY CONFERRAL
:178

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
1abvA           -SEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAE-SFIAVCGEQL
2bo5A           PVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMAKEKF


                         .         .         *         .         .         .         .:140
query           TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1abvA           DENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEAT---------------------------------
2bo5A           SPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV----------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1abvA           --------------------------------------
2bo5A           --------------------------------------