[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56702.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
   19::113     8e-07  36%  116 aa  PF00156 Pribosyltran "Phosphoribosyl transferase domain"
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00156         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
PF00156         ---------------------DKDVVVGIPRGGVPLAAALADALGVPFALIRKRRRRP---SSDEEERER


                         +         .         .         .         .         *         .:210
query           GSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAxxxxxxxxxxxxxxxxxxxxx
PF00156         GNVARLIRLVGDVKGKRVLLVDDVITTGGTLAAAAEALREAGAKVVYVA---------------------


                         .         .         .         +         .         .         .:280
query           xxxx
PF00156         ----