[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56724.1

[Show Plain Result]


## Summary of Sequence Search
    1::270
   10::105     2e-11  44%  108 aa  PF00581 Rhodanese "Rhodanese-like domain"
    8::105     1e-09  37%  108 aa  PF00581 Rhodanese "Rhodanese-like domain"(query 17->117)
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
PF00581         ----------------------------------------------------------------------
PF00581         ----------------LDDGDVVLLDVRSPEEYAEGHIPGAVNIPLPSL-----PLNGLLLSKDELAAAL


                         .         .         *         .         .         .         .:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWxxxxxxxxxxxxxxxxxxxxxxx
PF00581         ----------------------------------------------------------------------
PF00581         AAAGLDKDKPIVVYCRSGRSGAAAAAW-LKELGFPNVYVLDGGWKAW-----------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
PF00581         ----------------DGDVVLLDVRSPEEY--------AEGHIPGAVNIPLP---SLPLNGLLLSKDEL
PF00581         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWxxxxxxxxxx
PF00581         AAALAAAGIELDKDIVVYCRSGIRSAAAAAWLKELGFPNVYVLDGGWKAW----------
PF00581         ------------------------------------------------------------