[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56789.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
    3::172     7e-17  37%  177 aa  PF08443 RimK "RimK-like ATP-grasp domain"
   12::151     8e-05  33%  176 aa  PF02955 GSH-S_ATP "Prokaryotic glutathione synthetase, ATP-grasp
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08443         ----------------------------------------------------------------------
PF02955         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
PF08443         -------------------------------DKLRTLQLLARAGIPVPKTGVANSPEDALDL---IEELG
PF02955         ----------------------------------------------TPPTLVTRDAAQLRAF----LEEH


                         +         .         .         .         .         *         .:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
PF08443         FPVVIKPLDGSQGRGVVLAETREELESVEAFRGLILVQEFI----PEAGRDIRVFVVGGKVVAAMKRQSA
PF02955         GDVILKPLDGMGGAGIFRVKKD------DPNLGVILTEHGRRPVMPEIKEDKRILLVDGEPVPALARIPA


                         .         .         .         +         .         .         .:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALxxxxxxx
PF08443         DWRSNLHRGGKAEPVELTPEERELALKAAKALGLGVAGVDLLRS-NDGPLVLEVNSSPGLEGI-------
PF02955         GGETNLAAGGRGEARPLDREIAEAVGPTLKEKGLIFVGLDVI----------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08443         ---------------------------
PF02955         ---------------------------