[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56844.1

[Show Plain Result]


## Summary of Sequence Search
    1::276
    2::115     6e-23  44%  120 aa  PF01678 DAP_epimerase "Diaminopimelate epimerase"
   16::152     8e-06  30%  274 aa  PF02567 PhzC-PhzF "Phenazine biosynthesis-like protein"
    1::276

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
PF01678         -----TKMHGNGNDFVVVDDVDQEDLLTPELARALCDRHFGPGADNVLFVEVVD--EADARMRVFNRDGS
PF02567         ---------------VVLDADG----LSDEQMQAIARE---FNLSETAFVLPPTDPDADYRLRIFTPTG-


                         .         .         *         .         .         .         .:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
PF01678         ETEACGNGCRCAAAYLLDGGLVGKTEVTVETPGGILTVEVTEDGGVVVDMG-------------------
PF02567         EVPFCGHATLATAHALLERGGLGGGRITFETKAGLLPVRGDDDEGGLLELDFPRFRP--TPVDAEELAAL


                         +         .         .         .         .         *         .:210
query           YSLELDGQQVEIGAVSMGNPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01678         ----------------------------------------------------------------------
PF02567         LALDLD-EGLPIQVVSTGLP--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01678         ------------------------------------------------------------------
PF02567         ------------------------------------------------------------------