[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56902.1

[Show Plain Result]


## Summary of Sequence Search
    1::696
    3::236     8e-33  35%  236 aa  PF00563 EAL "EAL domain"
    4::159     7e-18  32%  160 aa  PF00990 GGDEF "GGDEF domain"
   23::131     3e-04  25%  580 aa  PF10345 Cohesin_load "Cohesin loading factor"
    1::99      8e-04  28%  111 aa  PF00072 Response_reg "Response regulator receiver domain"
    1::696

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCAAMLPQFSVAR
PF00563         ----------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------
PF10345         ------------------------------------TKVRSEEELEQYYKLIATAIKCLEALLKQFKLSP
PF00072         ---------ILIVDDDPVNRELLKRLLEKLGYV--VTTAEDGEEALELLEEHRPDLVLLDINMPGMDGLE


                         .         .         *         .         .         .         .:140
query           AAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
PF00563         ----------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------
PF10345         RQE----ARTRLRLARILLEETENDDLAETYLSKAILLAERNRLLRCQSLLARLLEKTNPKAALKNLDKL
PF00072         LLRRIRELEPDIP-IIVLTAYDDEEDAVRALEAGADDYLTK-----------------------------


                         +         .         .         .         .         *         .:210
query           LGESExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00563         ----------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------
PF10345         IEDSE-----------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDILTGFFS
PF00563         ----------------------------------------------------------------------
PF00990         --------------------------------------------------------------DPLTGLPN
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
PF00563         ----------------------------------------------------------------------
PF00990         RRAFEERLERLLARARREGRPLALLLLDLDHFKRINDTYGHAAGDEVLREVARRLREALREGDLVARLGG
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
PF00563         ----------------------------------------------------------------------
PF00990         DEFAILLPGTDLEEALEAAERARRLIESFPFRLDGQEVRVTVSIGVALYPDDGEDAEELLKRADQALYRA
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QEAGGNxxxxxxxxxxxxxxxxxxxxxxxQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
PF00563         -----------------------------ELRRALENGE-FELYYQPIVDLRTGRIVGYEALLRWRHPEG
PF00990         KKAGRN----------------------------------------------------------------
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
PF00563         GLISPDEFIPLAEETGLIVELDRWVLEEACRQLAEWRAQGPDLRLSVNLSPRQLLDPDFVERLLELLAET
PF00990         ----------------------------------------------------------------------
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
PF00563         GLPPERLVLEITESALIEDDAELLALLRRLRALGVRIALDDFGTGYSSLSYLKRLPVDILKIDRSFVRDI
PF00990         ----------------------------------------------------------------------
PF10345         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPxxxxxxxxxxxx
PF00563         DTDPEDRAIVRAIIALAHSLGLKVIAEGVETEEQLELLRELGCDLFQGYLFSKP------------
PF00990         ------------------------------------------------------------------
PF10345         ------------------------------------------------------------------
PF00072         ------------------------------------------------------------------