[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56915.1

[Show Plain Result]


## Summary of Sequence Search
    1::406
    1::123     7e-17  52%  123 aa  PF01743 PolyA_pol "Poly A polymerase head domain"
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPG
PF01743         --LYLVGGAVRDLLLGRPPKDID-IATDATPAKLFRRARKIVGRRFHVVLGGET-IEVATFRTEGYDGDG


                         .         .         *         .         .         .         .:140
query           YKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGILRxxxxxxxxxxxxxxxxxx
PF01743         RNPF-VEEFTD-TLEEDAYRRDFTINALADLQTGELIDPFGGLEDLRARVLR------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         --------------------------------------------------------