[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA56917.1

[Show Plain Result]


## Summary of Sequence Search
    1::454
    7::434     1e-66  38%  440 aa  PF00171 Aldedh "Aldehyde dehydrogenase family"
    1::454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxTGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
PF00171         ---------TGEVLAEVPAATAADVDAAVAAARAAFRAWAALSAEERAAILRAIADLLEANRDELAAAAT


                         .         .         *         .         .         .         .:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
PF00171         LETGKPLAEAKGEVARAADFLRYYAGLARRLAGEVLPEDPGLRIRVRREPLGVVGVITPWNFPLAVAAWK


                         +         .         .         .         .         *         .:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
PF00171         AAPALAAGNAVVLKPSEETPLSALALAELLREAGLPAGVVNLVPGPGAEVGALVAHPDVDLVSFTGSTAV


                         .         .         .         +         .         .         .:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
PF00171         GRAIMRAAAENLKPVTLELGGKNPVIVDEDADLDKAVEGIVNSKFFNAGQVCTAPERLLVHESIADEFLE


                         .         *         .         .         .         .         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
PF00171         ALAAALAALKVGDPLDPDTDLGPLISAAQFDRVEALIDDAVAEGAKVLAGGGADDEKGYFVEPTVLADVT


                         .         .         .         .         *         .         .:420
query           PGMPAFDEELFGPVAAIIRXXXXXXXXXXXXXSRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
PF00171         PDMRIAQEEIFGPVLPVVRFDDEDEAIALANDTEYGLTASVFTRDLARAERVARRLEAGRVWINDPTTGA


                         .         .         +         .         .         .         .:490
query           PRLPFGGIKCSGYGRExxxxxxxxxxxxxxxxxx
PF00171         AVAPFGGVKQSGIGRE------------------