[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57001.1

[Show Plain Result]


## Summary of Sequence Search
    1::548
    8::265     1e-32  38%  268 aa  PF00361 Oxidored_q1 "NADH-Ubiquinone/plastoquinone (complex I),
    5::60      2e-05  36%   61 aa  PF00662 Oxidored_q1_N "NADH-Ubiquinone oxidoreductase (complex
    1::548

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS
PF00361         ----------------------------------------------------------------------
PF00662         --------------------------------SWISNNDFSLEFGFLIDPLSSIMLILVTFVGSLVLIYS


                         .         .         *         .         .         .         .:140
query           VPYMADEAGRQRFFAWLSxxxxxxxxxxxxxxxxxxFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM
PF00361         ------------------------------------FIGWELVGLPSYLLIGFWGTRPRAAEAALKYFLT
PF00662         DGYMSHDPGYLRFFAYLS----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMA
PF00361         NRVGSLLLLLGILLLYWITGSLDFSDLFALA---GLNSLLLTLAALLLFIGFAAKSAQFPLHFWLPDAME
PF00662         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVS
PF00361         GPTPVSALILAATMVKAGIYLLLRLSPLLFASPYILPLLLILGLITALLGALLALAQTDLKRLLAYSSIS
PF00662         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXX
PF00361         HLGYMLGILGLGPYSGALFHLITHALFKALLFLLAGSIIHRTGSQDIRLMGGLWKKMPLTATAFLLGLLS
PF00662         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXPLLSGYWSEEELLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         LAGLPPLAGFWSKDLIL-----------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------
PF00662         ----------------------------------------------------------