[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57113.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    6::56      5e-05  45%  193 aa  PF00149 Metallophos "Calcineurin-like phosphoesterase"
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLxxxxxxx
PF00149         ----------------IGDLHGGLDDLGNALEEIAKEPKPDLVLFLGDLVDRGPPSEETLELL-------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00149         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00149         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
PF00149         ------------------