[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57125.1

[Show Plain Result]


## Summary of Sequence Search
    1::257
    4::249     2e-53  48%  249 aa  PF11932 DUF3450 "Protein of unknown function (DUF3450)"
   82::118     4e-04  38%  243 aa  PF08172 CASP_C "CASP C terminal"
    1::257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLYIVLTFVMGATMQGIGAPLESAIDAQVKADQAAARSQRKIDXXXXXXXXXXXXYRQVTTQ
PF11932         ---------LLLLLLLALSVSALAAAASLDQAQALQQQTNQAAAQSQQKIDKWADEKQDLLAEIRQLQRE
PF08172         ------------------------------------------------------------------VTSQ


                         .         .         *         .         .         .         .:140
query           LDSFRTYNRQLENLIRSQKEEFASLQQQLTDIEITQREIVPLMLRMVSSLKQFVALDIPFLPRERQTRIE
PF11932         VESLEVYNDQLERLVASQEKELASLQQQIEEIQETRQGLVPLMYQMIDGLEEFVALDLPFLLEERQERLE
PF08172         RDRFRRRNAELEEELRKLEQELSSLRQEVASLK-------------------------------------


                         +         .         .         .         .         *         .:210
query           QLQILMDRADVSLSEKYRRLIEAYQVEVEYGRTIEAYRGTLDMDGKPHTVDFLRVGRTALFFYTLDGKTS
PF11932         KLRELMDRADVSLAEKFRRILEAYQIEMDYGRKIEVYQGKITLDGEEVEVDFLRLGRLALYYQSLDGKQA
PF08172         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRWNAHGQSWVVLPDHYRAAIAEGLLIARKQAPPDLLLLPIQAPExx
PF11932         GMWDPQTRQWQALPDSYLSDIAKAIRIARKQAAPDLLKLPVEAAE--
PF08172         -----------------------------------------------