[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57191.1

[Show Plain Result]


## Summary of Sequence Search
    1::442
   19::106     8e-06  33%  192 aa  PF01609 Transposase_11 "Transposase DDE domain"
   88::148     4e-05  36%  199 aa  PF06021 Gly_acyl_tr_N "Aralkyl acyl-CoA:amino acid
    1::68      6e-05  36%   76 aa  PF05598 DUF772 "Transposase domain (DUF772)"
    1::442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGRPAIATRLIAGLHYLKH
PF01609         ----------------------------------------------------------------------
PF06021         ----------------------------------------------------------------------
PF05598         ----------------------------------------------------GRPAYDPEMMLKLLLLQY


                         .         .         *         .         .         .         .:140
query           TYGLSDEQVVQRWAENPYWQYFCGERYFQHELPLNPSSLTRWRQRLGDEGMESLLSATIDAAIASKAVKA
PF01609         ----------------------------------------------------------------------
PF06021         ---------------------------------LGTPEVINWKQHLQIQGSQSSLNEAIKELAASKSVKV
PF05598         LYGISDRQLEEELKENIAFRWFLG---LDLEDPVDHSTLSRFRKRLEEHGL-------------------


                         +         .         .         .         .         *         .:210
query           RDLKCVTVDTTVQEKAIAFPTDSKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01609         ----------------------------------------------------------------------
PF06021         KHSQCILYMTEETAKKLA-PSDSKL---------------------------------------------
PF05598         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01609         ----------------------------------------------------------------------
PF06021         ----------------------------------------------------------------------
PF05598         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxGVKVSIATTNRSNLVVGAQSLPGSPYDGHTLKKALHQVERLTGQRPERCYVDLGYRGHDVDDV
PF01609         -------GYKLHLAVDAEGGLILAVEVTPGNVHDSKTLPALLELLERLGG--PELVVADAGY-----DSE
PF06021         ----------------------------------------------------------------------
PF05598         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DVFKARQKRGVTRTIRRELKRRNAIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01609         ENLEALEERGIDYVIKKKLKKKERLE--------------------------------------------
PF06021         ----------------------------------------------------------------------
PF05598         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxx
PF01609         ----------------------
PF06021         ----------------------
PF05598         ----------------------