[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57498.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    2::119     3e-15  37%  132 aa  PF08534 Redoxin "Redoxin"
    1::120     7e-13  36%  122 aa  PF00578 AhpC-TSA "AhpC/TSA family"
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
PF08534         ----------LGDKAPDFTL-DALDGKPVTLSDFKGKV-VVLNFWASWCPPCRAEHPYLEELAEEYKAKG
PF00578         ----------LGDKAPDFTLPD-TDGGTVSLSDLKGKPVVLFFYPADFCPVCTTELPALAELYEEFKKRG


                         .         .         *         .         .         .         .:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRxxx
PF08534         VDVVGVN-------SDDDPFAVMRFLGKEGLPYPVLSDGDGEFGKALGVYGSPRTFLIDKDGKVVYR---
PF00578         VEVIGVSTDSVESH--------KAFAEKHGLPFPLLSDPDGEVARAYEGGALPATFLIDPDGKI------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08534         -----------------------------------------------------
PF00578         -----------------------------------------------------