[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57747.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
   35::210     2e-06  28%  212 aa  PF00510 COX3 "Cytochrome c oxidase subunit III"
   19::79      6e-04  33%  190 aa  PF09920 DUF2150 "Uncharacterized protein conserved in archaea
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASRHTDIVLGTIS
PF00510         ------------------------GMILFIFSEVMFFAAFFWAFFHSSLAWPPTGIEPLNPLELPL--LN
PF09920         ---------EEFDDPEEEDSARGFALLLNLQDDVILAVLIIAAYENGRLSKEEALEELEDVRDIVLSEV-


                         .         .         *         .         .         .         .:140
query           TGVLLTSGFTMALAVRSAKLGRDKAIIGXXXXXXXXXXXXXXXEGTEYYQAYGEQLIPAFNFMYEGAHEK
PF00510         TLILLASGVTVTWAHHALMEGNRKGAIQWLLLTILLGLYFTGLQAYEYYHA---------PFTISDS---
PF09920         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PVELFFFLYFLMTGMHAVHVTXXXXXXXXXXXXXXRRRFTSYYYTPVELTGLYWAFVDIVWIFLYPLFYx
PF00510         ---VYGSTFFMLTGFHGLHVIIGTIFLLVCLIRLLKGHFTSEHHFGFEAAAWYWHFVDVVWLFLFVFIY-
PF09920         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxx
PF00510         ----
PF09920         ----