[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57806.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
    1::121     4e-19  44%  122 aa  PF00578 AhpC-TSA "AhpC/TSA family"
    2::69      3e-06  36%  132 aa  PF08534 Redoxin "Redoxin"
    1::35      2e-04  54%   37 aa  PF10417 1-cysPrx_C "C-terminal domain of 1-Cys peroxiredoxin"
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
PF00578         ----LGDKAPDFTLPDTDGTVSLSDLKGKP-VVLFFYPADFCPVCTTELPALAELYEEFKKRGVEVIGVS
PF08534         ----LGDKAPDFTLDALDGPVTLSDFKGK--VVVLNFWASWCPPCRAEHPYLEELAEEYKAKGVDVVGVN
PF10417         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRxxxxxx
PF00578         TDSVESHKAFA----EKHG--LPFPLLSDPDGEVARAYGVLD---EEGGALPATFLIDPDGKIR------
PF08534         SDD-------------------------------------------------------------------
PF10417         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPxxxxxxxxxxxxxxxx
PF00578         ----------------------------------------------------------------------
PF08534         ----------------------------------------------------------------------
PF10417         ---------------ALQLVDKHGVVCPANWKPGDDVIIKPS---PEA-KKRFP----------------


                         .         .         .         +         .         .         .:280
query           xx
PF00578         --
PF08534         --
PF10417         --