[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57898.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    4::138     3e-09  30%  139 aa  PF00582 Usp "Universal stress protein family"
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxIIVTVDGSENXXXXXXXXXXXXXXXXNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQL
PF00582         -----------ILVAVDGSEESKRALRWAAALAARPGAELVLVHVVPPPP---YESASAGDGEAEEAAAE


                         .         .         *         .         .         .         .:140
query           KKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVIGRRGLSRFEALLLGSVSEKV
PF00582         AAEAAAEA--EALAALRAGGVVVETVVREGDPAEAILEAAEELGADLIVMGSRGRGGLRRLLLGSVAEYV


                         +         .         .         .         .         *         .:210
query           VRHASGPVTIIx
PF00582         LRHAPCPVLVV-