[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA57987.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
    3::206     1e-35  40%  207 aa  PF01385 Transposase_2 "Probable transposase"
    8::67      8e-11  47%   70 aa  PF07282 Transposase_35 "Putative transposase DNA-binding domain"
    1::46      9e-09  52%   46 aa  PF12323 HTH_14 "Helix-turn-helix domain"
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLKATKIRLYPTREQAEFLNRQFGSVRFCYNTGLRIMSHRYKRHGQxxxxxxxxxxxxxxxxxxxxxxxx
PF01385         ----------------------------------------------------------------------
PF07282         ----------------------------------------------------------------------
PF12323         MLKAYKFRLYPTKEQAALLARTFGCCRFVYNWALAERKEAYEEGGK------------------------


                         .         .         *         .         .         .         .:140
query           xEADSVALAQACINLDKAFQRFFKEKKGYPRFKRKRGKQSSYHCMSVSCGESWVKVPKLGPIKARVHRSV
PF01385         -ELSSQALQQALRDLDKAFKNFFKGRAGFPRFKKKRRRSSVYYKNSIKLDGGRIKLPKIGWVKLRLSRPI
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGKLKSITLSRTVTGKHYASLLYETEQPVPEPMTAIDATKVLGLDMGLSHLAIDSTGRKVANPRFIKQVQ
PF01385         PGKIKSVTVSKD-AGKWYLSITVEVEVPEPLPKTG----KVVGIDLGLKNLATTSDGEKIVNPRFLKKLE
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KNXXXXXXXXXXXXXXXXXXXXXXXXXXXXHERVADARSDFQHKLSRQIVDDNQAVIVETLKVNNMMKNx
PF01385         KRLKKLQRRLSRKKKGSKNRRKARRKLARLHRKIANQRKDFLHKLSTKLVKEADLIVVEDLNVKNMVKN-
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxLAYKAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDR
PF01385         ----------------------------------------------------------------------
PF07282         -----------------LEYKAEWYGIEVIEVDEAY-TSQTCSVCGHKKKKNRLSDREFKCPNCGTVIDR
PF12323         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DINAALNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01385         -----------------------------------------------
PF07282         DVNAALNI---------------------------------------
PF12323         -----------------------------------------------