[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58132.1

[Show Plain Result]


## Summary of Sequence Search
    1::206
    2::187     2e-43  47%  188 aa  PF02223 Thymidylate_kin "Thymidylate kinase"
    1::206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
PF02223         --EGIDGSGKTTQIKLLAERLEAQGIKVVLTREPGGTPIGELIRELLLGKN-EDLDPRTEALLFAADRAQ


                         .         .         *         .         .         .         .:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
PF02223         HLEEVIKPALARGKIVICDRYIDSTLAYQGAGRGLDLDLVAQLNDFALGGLKPDLTLYLDVPPEVALARA


                         +         .         .         .         .         *         .:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQExxxxxxxxxxxxxxxx
PF02223         RAR-GELDRIEEEDLEFHERVREGYLELAAAEPERIVVIDASQSIEEVHE----------------