[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58185.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
   11::151     7e-14  38%  171 aa  PF00753 Lactamase_B "Metallo-beta-lactamase superfamily"
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
PF00753         --------------------ETGGGAILIDTGGTPEQLLLLALLGLKKIDAILITHGHADHIGGLPYLLE


                         .         .         *         .         .         .         .:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
PF00753         ALPVPVVAHPLTAALLLELLLEDALLL--PPELIVVV---LEDGDGIGGGVVVLFVPAGHGHGPGSIVLE


                         +         .         .         .         .         *         .:210
query           HPESHLALVGDVLFKGSIGRTDFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00753         LPGGKVLFTGDTLFDGGPGLIDF-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           xx
PF00753         --