[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58187.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
    1::368     e-108  53%  369 aa  PF04339 DUF482 "Protein of unknown function, DUF482"
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSIETVASGQWNALEGTDNPFLRYEFLSALERYGCVGAHVGWLPRYLLAEDRPGSLIGAVPLYL
PF04339         -------SISEIPAAEWDALAGPDNPFLRHAFLSALEESGSAGPRTGWQPRHLTLWDG-GRLVAAAPLYL


                         .         .         *         .         .         .         .:140
query           KYNSFGEFVFDWSWADAWEQAGQHYYPKLVVAVPFSPVTGPRLLLKPGADEAMVDELIQMTIRLAKKGGI
PF04339         KSHSYGEYVFDWAWADAYERAGLRYYPKLLCAVPFTPVTGPRLLVAPGEDRAALRALLAALDQLAEQSGL


                         +         .         .         .         .         *         .:210
query           SSLHWLFPHQKDRKRLANCGFLLRQGYQFHWHNRGYRDFNDFLETLTSXXXXXXXXXXXQAQTRGTEIKV
PF04339         SSLHVLFPTPEEAALLEEAGFLQRLGVQFHWLNRGYRDFDDFLAALSSRKRKNIRRERRKVAEAGITFRR


                         .         .         .         +         .         .         .:280
query           IHGSEVTDLEWRAMYRFYQATFHAKGNYPALTLPFFKSLGRTMGQAVVLALAVRTGIPIAGALYLRSRDT
PF04339         LTGDDITDEDWDAFYRFYQDTYARRWGRPYLTREFFELLGETMPDRVLLVVAERDGRPIAGALNLIGGDT


                         .         *         .         .         .         .         +:350
query           LYGRYWGDSEYLAGMHFELCYYRGIEYCIEHHLQYFEPGAQGEHKINRGFLPVLTWSAHWLGDSGFYSAI
PF04339         LYGRYWGALEEIPFLHFELCYYQGIEYAIEHGLKRFEAGAQGEHKLARGFLPVPTYSAHWIAHPGFRDAI


                         .         .         .         .         *         .         .:420
query           ADFLAQESRMVRSAIMELEAGGPYKxx
PF04339         ADFLERERAAVEAYIEELNEHLPFR--