[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58417.1

[Show Plain Result]


## Summary of Sequence Search
    1::468
    3::159     4e-06  38%  159 aa  PF04932 Wzy_C "O-Antigen ligase"
    1::468

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04932         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04932         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxATFALTFIA
PF04932         -------------------------------------------------------------ALLLLLLLA


                         .         .         .         +         .         .         .:280
query           VPFTYSRGAMLGLAVVSVLLFMRWRNKALLVIMLIPILFGGLAFVPEKLFNRAESIQNYEMDASSMQRIA
PF04932         LLLTGSRGAWLALLVALLLLLLRRKRRLLLLILLIIILFAGLKLVKGILLNRIARLVEGSGDSSSSGRLY


                         .         *         .         .         .         .         +:350
query           AWDLAWNIAIDRPLRGGGFEYEGDTARWHTYLDPKYYYVMEGAHVAHSIYFQMLGQHGFVGLSLFMxxxx
PF04932         IWRDALEMIKEHPLLGGPGTFWG--AWYAAYRDYAYESYGYTATHAHNLYLQILVETGIIGLLLFL----


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04932         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04932         ------------------------------------------------