[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58511.1

[Show Plain Result]


## Summary of Sequence Search
    1::111
    4::104     2e-14  48%  114 aa  PF01710 Transposase_14 "Transposase"
    1::111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHKLDWEALRVHVED
PF01710         ----SIDLRQKVIAAVEEGGSITEAAKRFGVSRNTIYRWLKRKERTGDLNPKPRKGRKIDWEELKAFVEE


                         .         .         *         .         .         .         .:140
query           KAALTYKERARHFGVSYYCIWHAMHKMGLTRKKxxxxxxxx
PF01710         HPDATLKEIAEELGVSPSTISRALKKLGFTRKK--------