[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58618.1

[Show Plain Result]


## Summary of Sequence Search
    1::690
   21::656       0.0  53%  656 aa  PF00771 FHIPEP "FHIPEP family"
    1::690

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFNISXXXXXXXXGVYARRPLDFSSF
PF00771         ---------------------------------------------FNIALSVLILLVALYIPRPLDFSAF


                         .         .         *         .         .         .         .:140
query           PTIXXXXXXXXXXXNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYAXXXXXXXXXXXXXXXXXTKG
PF00771         PTLLLITTLFRLALNIASTRLILLEGD-----AGHVIEAFGQFVVGGNLVVGLVVFLILTIVQFIVITKG


                         +         .         .         .         .         *         .:210
query           ATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLRREEVMQEADFYGSMDGAGKFVRXXXXXXXX
PF00771         AERVAEVAARFTLDAMPGKQMAIDADLNAGLIDEEEARKRRAELAQESDFYGAMDGASKFVKGDAIAGII


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXVGLLQHDLSFSEAARNYTLLTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQ
PF00771         ITLINIIGGIAIGVLQHGMSAGEAAQTYTLLTIGDGLVSQIPALLISTAAGIIVTRVSSDENLGEQIVSQ


                         .         *         .         .         .         .         +:350
query           LFKNPKSLAVVAVVLGSMGLIPGMPNXXXXXXXXXXXXXVWWLGKRQKAEVAPTPPMAAPSETPELSWED
PF00771         LFANPKALLIAAGLLLLLGLVPGMPTLPFLLLAALLGFLAYRLSKRKKAAAAEAAAEAAEAEAAEESWDD


                         .         .         .         .         *         .         .:420
query           IPPVDPIGLEVGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT
PF00771         VLPVDPLELELGYRLIPLVDKAQGGELLDRIRGIRKKLAQELGFLLPGIRIRDNLQLPPNEYRILIKGVE


                         .         .         +         .         .         .         .:490
query           VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGTVIATHLSQIL
PF00771         VARGELYPDKLLAINPGGVLGELPGIPTKEPAFGLPAVWIDEDQKEQAQALGYTVVDPSTVIATHLSEVL


                         *         .         .         .         .         +         .:560
query           QNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEHGL
PF00771         RRHAAELLGRQEVQQLLDRLEKDYPKLVEELVPKVLPLGRIQKVLQRLLEERVSIRDLRTILETLAEWAP


                         .         .         .         *         .         .         .:630
query           RSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPALEQLLLASLQTASEGGGLNMEPGLAEKLHLT
PF00771         KEKDPDMLTEYVRQALGRQITQRYAGGDGELPVITLDPELEQLLRQSIRQTSGGSFLALEPELAERLLEQ


                         .         +         .         .         .         .         *:700
query           LRDSVQRQEAAGKPAILLVQGVLRPWLARFVRHAIPELKVLSYNEIPEDKQVxxxxxxxx
PF00771         LREALERQEAAGAPPVLLVSPDLRRYLRRLLERFLPDLPVLSYQEIPDEVEL--------